wireshark/plugins/infiniband/packet-infiniband.h

/* packet-infiniband.h
 * Routines for Infiniband/ERF Dissection
 *
 * $Id$
 *
 * Copyright 2008 Endace Technology Limited
 *
 * This program is free software; you can redistribute it and/or
 * modify it under the terms of the GNU General Public License
 * as published by the Free Software Foundation; either version 2
 * of the License, or (at your option) any later version.
 *
 * This program is distributed in the hope that it will be useful,
 * but WITHOUT ANY WARRANTY; without even the implied warranty of
 * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
 * GNU General Public License for more details.
 *
 * You should have received a copy of the GNU General Public License
 * along with this program; if not, write to the Free Software
 * Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
 */
#ifndef __PACKET_INFINIBAND_H_
#define __PACKET_INFINIBAND_H_

#define PROTO_TAG_INFINIBAND	"Infiniband"

#include <epan/etypes.h>

/* Wireshark ID */
static int proto_infiniband = -1;

/* Variables to hold expansion values between packets */
static gint ett_infiniband = -1;
static gint ett_all_headers = -1;
static gint ett_lrh = -1;
static gint ett_grh = -1;
static gint ett_bth = -1;
static gint ett_rwh = -1;
static gint ett_rawdata = -1;
static gint ett_rdeth = -1;
static gint ett_deth = -1;
static gint ett_reth = -1;
static gint ett_atomiceth = -1;
static gint ett_aeth = -1;
static gint ett_atomicacketh = -1;
static gint ett_immdt = -1;
static gint ett_ieth = -1;
static gint ett_payload = -1;
static gint ett_vendor = -1;
static gint ett_subn_lid_routed = -1;
static gint ett_subn_directed_route = -1;
static gint ett_subnadmin = -1;
static gint ett_mad = -1;
static gint ett_rmpp = -1;
static gint ett_subm_attribute = -1;
static gint ett_suba_attribute = -1;
static gint ett_datadetails = -1;
static gint ett_noticestraps = -1;
static gint ett_nodedesc = -1;
static gint ett_nodeinfo = -1;
static gint ett_switchinfo = -1;
static gint ett_guidinfo = -1;
static gint ett_portinfo = -1;
static gint ett_portinfo_capmask = -1;
static gint ett_pkeytable = -1;
static gint ett_sltovlmapping = -1;
static gint ett_vlarbitrationtable = -1;
static gint ett_linearforwardingtable = -1;
static gint ett_randomforwardingtable = -1;
static gint ett_multicastforwardingtable = -1;
static gint ett_sminfo = -1;
static gint ett_vendordiag = -1;
static gint ett_ledinfo = -1;
static gint ett_linkspeedwidthpairs = -1;
static gint ett_informinfo = -1;
static gint ett_linkrecord = -1;
static gint ett_servicerecord = -1;
static gint ett_pathrecord = -1;
static gint ett_mcmemberrecord = -1;
static gint ett_tracerecord = -1;
static gint ett_multipathrecord = -1;
static gint ett_serviceassocrecord = -1;

/* Global ref to highest level tree should we find other protocols encapsulated in IB */
static proto_tree *top_tree = NULL;
 
/* MAD_Data
* Structure to hold information from the common MAD header.
* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
typedef struct {
	guint8 managementClass;
	guint8 classVersion;
	guint8 method;
	guint8 status;
	guint16 classSpecific;
	guint64 transactionID;
	guint16 attributeID;
	guint32 attributeModifier;
	char data[232];
} MAD_Data;

/* Dissector Declarations */
static dissector_handle_t ipv6_handle;
static dissector_handle_t data_handle;
static dissector_table_t ethertype_dissector_table;

static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree);
static gint32 find_next_header_sequence(guint32 OpCode);
static gboolean contains(guint32 value, guint32* arr, int length);
static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo);

/* Parsing Methods for specific IB headers. */

static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *);
static void parse_PAYLOAD(proto_tree *, packet_info *, tvbuff_t *, gint *, gint length, guint8 virtualLane);
static void parse_IETH(proto_tree *, tvbuff_t *, gint *);
static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset);
static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset);
static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *);

static void parse_SUBN_LID_ROUTED(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
static void parse_SUBNADMN(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset);
static void parse_BM(proto_tree *, tvbuff_t *, gint *offset);
static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset);
static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset);
static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset);
static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);

static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset);
static void label_SUBM_Method(proto_item*, MAD_Data*, packet_info*);
static void label_SUBM_Attribute(proto_item*, MAD_Data*, packet_info*);
static void label_SUBA_Method(proto_item*, MAD_Data*, packet_info*);
static void label_SUBA_Attribute(proto_item*, MAD_Data*, packet_info*);

/* Class Attribute Parsing Routines */
static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);

/* These methods parse individual attributes
* Naming convention FunctionHandle = "parse_" + [Attribute Name]; 
* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
* Subnet Management */
static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset);
static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset);
static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset);
static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset);

/* Subnet Administration */
static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset);
static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset);
static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset);

/* Subnet Administration */
static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);

/* SM Methods */
static const value_string SUBM_Methods[] = {
	{ 0x01, "SubnGet("},
	{ 0x02, "SubnSet("},
	{ 0x81, "SubnGetResp("},
	{ 0x05, "SubnTrap("},
	{ 0x07, "SubnTrapResp("},
	{ 0, NULL}
};
/* SM Attributes */
static const value_string SUBM_Attributes[] = {
	{ 0x0001, "Attribute (ClassPortInfo)"},
	{ 0x0002, "Attribute (Notice)"},
	{ 0x0003, "Attribute (InformInfo)"},
	{ 0x0010, "Attribute (NodeDescription)"},
	{ 0x0011, "Attribute (NodeInfo)"},
	{ 0x0012, "Attribute (SwitchInfo)"},
	{ 0x0014, "Attribute (GUIDInfo)"},
	{ 0x0015, "Attribute (PortInfo)"},
	{ 0x0016, "Attribute (P_KeyTable)"},
	{ 0x0017, "Attribute (SLtoVLMapptingTable)"},
	{ 0x0018, "Attribute (VLArbitrationTable)"},
	{ 0x0019, "Attribute (LinearForwardingTable)"},
	{ 0x001A, "Attribute (RandomForwardingTable)"},
	{ 0x001B, "Attribute (MulticastForwardingTable)"},
	{ 0x001C, "Attribute (LinkSpeedWidthPairsTable)"},
	{ 0x0020, "Attribute (SMInfo)"},
	{ 0x0030, "Attribute (VendorDiag)"},
	{ 0x0031, "Attribute (LedInfo)"},
	{ 0, NULL}
};

/* SA Methods */
static const value_string SUBA_Methods[] = {
	{ 0x01, "SubnAdmGet("},
	{ 0x81, "SubnAdmGetResp("},
	{ 0x02, "SubnAdmSet("},
	{ 0x06, "SubnAdmReport("},
	{ 0x86, "SubnAdmReportResp("},
	{ 0x12, "SubnAdmGetTable("},
	{ 0x92, "SubnAdmGetTableResp("},
	{ 0x13, "SubnAdmGetTraceTable("},
	{ 0x14, "SubnAdmGetMulti("},
	{ 0x94, "SubnAdmGetMultiResp("},
	{ 0x15, "SubnAdmDelete("},
	{ 0x95, "SubnAdmDeleteResp("},
	{ 0, NULL}
};
/* SA Attributes */
static const value_string SUBA_Attributes[] = {
	{ 0x0001, "Attribute (ClassPortInfo)"},
	{ 0x0002, "Attribute (Notice)"},
	{ 0x0003, "Attribute (InformInfo)"},
	{ 0x0011, "Attribute (NodeRecord)"},
	{ 0x0012, "Attribute (PortInfoRecord)"},
	{ 0x0013, "Attribute (SLtoVLMappingTableRecord)"},
	{ 0x0014, "Attribute (SwitchInfoRecord)"},
	{ 0x0015, "Attribute (LinearForwardingTableRecord)"},
	{ 0x0016, "Attribute (RandomForwardingTableRecord)"},
	{ 0x0017, "Attribute (MulticastForwardingTableRecord)"},
	{ 0x0018, "Attribute (SMInfoRecord)"},
	{ 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"},
	{ 0x00F3, "Attribute (InformInfoRecord)"},
	{ 0x0020, "Attribute (LinkRecord)"},
	{ 0x0030, "Attribute (GuidInfoRecord)"},
	{ 0x0031, "Attribute (ServiceRecord)"},
	{ 0x0033, "Attribute (P_KeyTableRecord)"},
	{ 0x0035, "Attribute (PathRecord)"},
	{ 0x0036, "Attribute (VLArbitrationTableRecord)"},
	{ 0x0038, "Attribute (MCMembersRecord)"},
	{ 0x0039, "Attribute (TraceRecord)"},
	{ 0x003A, "Attribute (MultiPathRecord)"},
	{ 0x003B, "Attribute (ServiceAssociationRecord)"},
	{ 0, NULL}
};


/* RMPP Types */
#define RMPP_ILLEGAL 0
#define RMPP_DATA	1
#define RMPP_ACK	2
#define RMPP_STOP	3
#define RMPP_ABORT	4

static const value_string RMPP_Packet_Types[] = {
	{ RMPP_ILLEGAL, " Illegal RMPP Type (0)! " },
	{ RMPP_DATA, "RMPP (DATA)" }, 
	{ RMPP_ACK, "RMPP (ACK)" }, 
	{ RMPP_STOP, "RMPP (STOP)" }, 
	{ RMPP_ABORT, "RMPP (ABORT)" }, 
	{ 0, NULL}
};

static const value_string RMPP_Flags[] = {
	{ 3, " (Transmission Sequence - First Packet)"},
	{ 5, " (Transmission Sequence - Last Packet)"},
	{ 1, " (Transmission Sequence) " },
	{ 0, NULL}
};

static const value_string RMPP_Status[]= {
	{ 0, " (Normal)"},
	{ 1, " (Resources Exhausted)"},
	{ 118, " (Total Time Too Long)"},
	{ 119, " (Inconsistent Last and PayloadLength)"},
	{ 120, " (Inconsistent First and Segment Number)"},
	{ 121, " (Bad RMPPType)"},
	{ 122, " (NewWindowLast Too Small)"},
	{ 123, " (SegmentNumber Too Big)"},
	{ 124, " (Illegal Status)"},
	{ 125, " (Unsupported Version)"},
	{ 126, " (Too Many Retries)"},
	{ 127, " (Unspecified - Unknown Error Code on ABORT)"},
	{ 0, NULL}
};

static const value_string DiagCode[]= {
	{0x0000, "Function Ready"},
	{0x0001, "Performing Self Test"},
	{0x0002, "Initializing"},
	{0x0003, "Soft Error - Function has non-fatal error"},
	{0x0004, "Hard Error - Function has fatal error"},
	{ 0, NULL}
};
static const value_string LinkWidthEnabled[]= {
	{0x0000, "No State Change"},
	{0x0001, "1x"},
	{0x0002, "4x"},
	{0x0003, "1x or 4x"},
	{0x0004, "8x"},
	{0x0005, "1x or 8x"},
	{0x0006, "4x or 8x"},
	{0x0007, "1x or 4x or 8x"},
	{0x0008, "12x"},
	{0x0009, "1x or 12x"},
	{0x000A, "4x or 12x"},
	{0x000B, "1x or 4x or 12x"},
	{0x000C, "8x or 12x"},
	{0x000D, "1x or 8x or 12x"},
	{0x000E, "4x or 8x or 12x"},
	{0x000E, "1x or 4x or 8x or 12x"},
	{0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"},
	{ 0, NULL}
};

static const value_string LinkWidthSupported[]= {
	{0x0001, "1x"},
	{0x0003, "1x or 4x"},
	{0x0007, "1x or 4x or 8x"},
	{0x000B, "1x or 4x or 12x"},
	{0x000F, "1x or 4x or 8x or 12x"},
	{ 0, NULL}
};
static const value_string LinkWidthActive[]= {
	{0x0001, "1x"},
	{0x0002, "4x"},
	{0x0004, "8x"},
	{0x0008, "12x"},
	{ 0, NULL}
};
static const value_string LinkSpeedSupported[]= {
	{0x0001, "2.5 Gbps"},
	{0x0003, "2.5 or 5.0 Gbps"},
	{0x0005, "2.5 or 10.0 Gbps"},
	{0x0007, "2.5 or 5.0 or 10.0 Gbps"},
	{ 0, NULL}
};
static const value_string PortState[]= {
	{0x0000, "No State Change"},
	{0x0001, "Down (includes failed links)"},
	{0x0002, "Initialized"},
	{0x0003, "Armed"},
	{0x0004, "Active"},
	{ 0, NULL}
};
static const value_string PortPhysicalState[]= {
	{0x0000, "No State Change"},
	{0x0001, "Sleep"},
	{0x0002, "Polling"},
	{0x0003, "Disabled"},
	{0x0004, "PortConfigurationTraining"},
	{0x0005, "LinkUp"},
	{0x0006, "LinkErrorRecovery"},
	{0x0007, "Phy Test"},
	{ 0, NULL}
};
static const value_string LinkDownDefaultState[]= {
	{0x0000, "No State Change"},
	{0x0001, "Sleep"},
	{0x0002, "Polling"},
	{ 0, NULL}
};
static const value_string LinkSpeedActive[]= {
	{0x0001, "2.5 Gbps"},
	{0x0002, "5.0 Gbps"},
	{0x0004, "10.0 Gbps"},
	{ 0, NULL}
};
static const value_string LinkSpeedEnabled[]= {
	{0x0000, "No State Change"},
	{0x0001, "2.5 Gbps"},
	{0x0003, "2.5 or 5.0 Gbps"},
	{0x0005, "2.5 or 10.0 Gbps"},
	{0x0007, "2.5 or 5.0 or 10.0 Gbps"},
	{0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"},
	{ 0, NULL}
};
static const value_string NeighborMTU[]= {
	{0x0001, "256"},
	{0x0002, "512"},
	{0x0003, "1024"},
	{0x0004, "2048"},
	{0x0005, "4096"},
	{ 0, NULL}
};
static const value_string VLCap[]= {
	{0x0001, "VL0"},
	{0x0002, "VL0, VL1"},
	{0x0003, "VL0 - VL3"},
	{0x0004, "VL0 - VL7"},
	{0x0005, "VL0 - VL14"},
	{ 0, NULL}
};
static const value_string MTUCap[]= {
	{0x0001, "256"},
	{0x0002, "512"},
	{0x0003, "1024"},
	{0x0004, "2048"},
	{0x0005, "4096"},
	{ 0, NULL}
};
static const value_string OperationalVLs[]= {
	{0x0000, "No State Change"},
	{0x0001, "VL0"},
	{0x0002, "VL0, VL1"},
	{0x0003, "VL0 - VL3"},
	{0x0004, "VL0 - VL7"},
	{0x0005, "VL0 - VL14"},
	{ 0, NULL}
};

/* Local Route Header (LRH) */
static int hf_infiniband_LRH = -1;
static int hf_infiniband_virtual_lane = -1;
static int hf_infiniband_link_version = -1;
static int hf_infiniband_service_level = -1;
static int hf_infiniband_reserved2 = -1;
static int hf_infiniband_link_next_header = -1;
static int hf_infiniband_destination_local_id = -1;
static int hf_infiniband_reserved5 = -1;
static int hf_infiniband_packet_length = -1;
static int hf_infiniband_source_local_id = -1;	
/* Global Route Header (GRH) */
static int hf_infiniband_GRH = -1;
static int hf_infiniband_ip_version = -1;
static int hf_infiniband_traffic_class = -1;
static int hf_infiniband_flow_label = -1;
static int hf_infiniband_payload_length = -1;
static int hf_infiniband_next_header = -1;
static int hf_infiniband_hop_limit = -1;
static int hf_infiniband_source_gid = -1;
static int hf_infiniband_destination_gid = -1;	
/* Base Transport Header (BTH) */
static int hf_infiniband_BTH = -1;
static int hf_infiniband_opcode = -1;
static int hf_infiniband_solicited_event = -1;
static int hf_infiniband_migreq = -1;
static int hf_infiniband_pad_count = -1;
static int hf_infiniband_transport_header_version = -1;
static int hf_infiniband_partition_key = -1;
static int hf_infiniband_reserved8 = -1;
static int hf_infiniband_destination_qp = -1;
static int hf_infiniband_acknowledge_request = -1;
static int hf_infiniband_reserved7 = -1;
static int hf_infiniband_packet_sequence_number = -1;	
/* Raw Header (RWH) */
static int hf_infiniband_RWH = -1;
static int hf_infiniband_reserved16_RWH = -1;
static int hf_infiniband_etype = -1;
/* Reliable Datagram Extended Transport Header (RDETH) */
static int hf_infiniband_RDETH = -1;
static int hf_infiniband_reserved8_RDETH = -1;
static int hf_infiniband_ee_context = -1;
/* Datagram Extended Transport Header (DETH) */
static int hf_infiniband_DETH = -1;
static int hf_infiniband_queue_key = -1;
static int hf_infiniband_reserved8_DETH = -1;
static int hf_infiniband_source_qp = -1;	
/* RDMA Extended Transport Header (RETH) */
static int hf_infiniband_RETH = -1;
static int hf_infiniband_virtual_address = -1;
static int hf_infiniband_remote_key = -1;
static int hf_infiniband_dma_length = -1;	
/* Atomic Extended Transport Header (AtomicETH) */
static int hf_infiniband_AtomicETH = -1;
static int hf_infiniband_virtual_address_AtomicETH = -1;
static int hf_infiniband_remote_key_AtomicETH = -1;
static int hf_infiniband_swap_or_add_data = -1;
static int hf_infiniband_compare_data = -1;	
/* ACK Extended Transport Header (AETH) */
static int hf_infiniband_AETH = -1;
static int hf_infiniband_syndrome = -1;
static int hf_infiniband_message_sequence_number = -1;
/* Atomic ACK Extended Transport Header (AtomicAckETH) */
static int hf_infiniband_AtomicAckETH = -1;
static int hf_infiniband_original_remote_data = -1;
/* Immediate Extended Transport Header (ImmDt) */
static int hf_infiniband_IMMDT = -1;
/* Invalidate Extended Transport Header (IETH) */
static int hf_infiniband_IETH = -1;
/* Payload */
static int hf_infiniband_payload = -1;
static int hf_infiniband_invariant_crc = -1;
static int hf_infiniband_variant_crc = -1;
/* Unknown or Vendor Specific */
static int hf_infiniband_raw_data = -1;
static int hf_infiniband_vendor = -1;
/* MAD Base Header */
static int hf_infiniband_MAD = -1;
static int hf_infiniband_base_version = -1;
static int hf_infiniband_mgmt_class = -1;
static int hf_infiniband_class_version = -1;
static int hf_infiniband_reserved1 = -1;
static int hf_infiniband_method = -1;
static int hf_infiniband_status = -1;
static int hf_infiniband_class_specific = -1;
static int hf_infiniband_transaction_id = -1;
static int hf_infiniband_attribute_id = -1;
static int hf_infiniband_reserved16 = -1;
static int hf_infiniband_attribute_modifier = -1;
static int hf_infiniband_data = -1;
/* RMPP Header */
static int hf_infiniband_RMPP = -1;
static int hf_infiniband_rmpp_version = -1;
static int hf_infiniband_rmpp_type = -1;
static int hf_infiniband_r_resp_time = -1;
static int hf_infiniband_rmpp_flags = -1;
static int hf_infiniband_rmpp_status = -1;
static int hf_infiniband_rmpp_data1 = -1;
static int hf_infiniband_rmpp_data2 = -1;
/* RMPP Data */
static int hf_infiniband_RMPP_DATA = -1;
static int hf_infiniband_segment_number = -1;
static int hf_infiniband_payload_length32 = -1;
static int hf_infiniband_transferred_data = -1;
/* RMPP ACK */
static int hf_infiniband_new_window_last = -1;
static int hf_infiniband_reserved220 = -1;
/* RMPP ABORT and STOP */
static int hf_infiniband_reserved32 = -1;
static int hf_infiniband_optional_extended_error_data = -1;
/* SMP Data LID Routed */
static int hf_infiniband_SMP_LID = -1;
static int hf_infiniband_m_key = -1;
static int hf_infiniband_smp_data = -1;
static int hf_infiniband_reserved1024 = -1;
static int hf_infiniband_reserved256 = -1;
/* SMP Data Directed Route */
static int hf_infiniband_SMP_DIRECTED = -1;
static int hf_infiniband_smp_status = -1;
static int hf_infiniband_hop_pointer = -1;
static int hf_infiniband_hop_count = -1;
static int hf_infiniband_dr_slid = -1;
static int hf_infiniband_dr_dlid = -1;
static int hf_infiniband_reserved28 = -1;
static int hf_infiniband_d = -1;
static int hf_infiniband_initial_path = -1;
static int hf_infiniband_return_path = -1;
/* SA MAD Header */
static int hf_infiniband_SA = -1;
static int hf_infiniband_sm_key = -1;
static int hf_infiniband_attribute_offset = -1;
static int hf_infiniband_component_mask = -1;
static int hf_infiniband_subnet_admin_data = -1;

/* Attributes
* Additional Structures for individuala attribute decoding.
* Since they are not headers the naming convention is slightly modified
* Convention: hf_infiniband_[attribute name]_[field]
* This was not entirely necessary but I felt the previous convention
* did not provide adequate readability for the granularity of attribute/attribute fields. */

/* NodeDescription */
static int hf_infiniband_NodeDescription_NodeString = -1;
/* NodeInfo */
static int hf_infiniband_NodeInfo_BaseVersion = -1;
static int hf_infiniband_NodeInfo_ClassVersion = -1;
static int hf_infiniband_NodeInfo_NodeType = -1;
static int hf_infiniband_NodeInfo_NumPorts = -1;
static int hf_infiniband_NodeInfo_SystemImageGUID = -1;
static int hf_infiniband_NodeInfo_NodeGUID = -1;
static int hf_infiniband_NodeInfo_PortGUID = -1;
static int hf_infiniband_NodeInfo_PartitionCap = -1;
static int hf_infiniband_NodeInfo_DeviceID = -1;
static int hf_infiniband_NodeInfo_Revision = -1;
static int hf_infiniband_NodeInfo_LocalPortNum = -1;
static int hf_infiniband_NodeInfo_VendorID = -1;
/* SwitchInfo */
static int hf_infiniband_SwitchInfo_LinearFDBCap = -1;
static int hf_infiniband_SwitchInfo_RandomFDBCap = -1;
static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1;
static int hf_infiniband_SwitchInfo_LinearFDBTop = -1;
static int hf_infiniband_SwitchInfo_DefaultPort = -1;
static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1;
static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1;
static int hf_infiniband_SwitchInfo_LifeTimeValue = -1;
static int hf_infiniband_SwitchInfo_PortStateChange = -1;
static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1;
static int hf_infiniband_SwitchInfo_LIDsPerPort = -1;
static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1;
static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1;
static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1;
static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1;
static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1;
static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1;
/* GUIDInfo */
static int hf_infiniband_GUIDInfo_GUIDBlock = -1;
static int hf_infiniband_GUIDInfo_GUID = -1;
/* PortInfo */
static int hf_infiniband_PortInfo_GidPrefix = -1;
static int hf_infiniband_PortInfo_LID = -1;
static int hf_infiniband_PortInfo_MasterSMLID = -1;
static int hf_infiniband_PortInfo_CapabilityMask = -1;

/* Capability Mask Flags */
static int hf_infiniband_PortInfo_CapabilityMask_SM;
static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1;
static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1;
static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1;
static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1;
static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1;
/* End Capability Mask Flags */


static int hf_infiniband_PortInfo_DiagCode = -1;
static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1;
static int hf_infiniband_PortInfo_LocalPortNum = -1;
static int hf_infiniband_PortInfo_LinkWidthEnabled = -1;
static int hf_infiniband_PortInfo_LinkWidthSupported = -1;
static int hf_infiniband_PortInfo_LinkWidthActive = -1;
static int hf_infiniband_PortInfo_LinkSpeedSupported = -1;
static int hf_infiniband_PortInfo_PortState = -1;
static int hf_infiniband_PortInfo_PortPhysicalState = -1;
static int hf_infiniband_PortInfo_LinkDownDefaultState = -1;
static int hf_infiniband_PortInfo_M_KeyProtectBits = -1;
static int hf_infiniband_PortInfo_LMC = -1;
static int hf_infiniband_PortInfo_LinkSpeedActive = -1;
static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1;
static int hf_infiniband_PortInfo_NeighborMTU = -1;
static int hf_infiniband_PortInfo_MasterSMSL = -1;
static int hf_infiniband_PortInfo_VLCap = -1;
static int hf_infiniband_PortInfo_M_Key = -1;
static int hf_infiniband_PortInfo_InitType = -1;
static int hf_infiniband_PortInfo_VLHighLimit = -1;
static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1;
static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1;
static int hf_infiniband_PortInfo_InitTypeReply = -1;
static int hf_infiniband_PortInfo_MTUCap = -1;
static int hf_infiniband_PortInfo_VLStallCount = -1;
static int hf_infiniband_PortInfo_HOQLife = -1;
static int hf_infiniband_PortInfo_OperationalVLs = -1;
static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1;
static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1;
static int hf_infiniband_PortInfo_FilterRawInbound = -1;
static int hf_infiniband_PortInfo_FilterRawOutbound = -1;
static int hf_infiniband_PortInfo_M_KeyViolations = -1;
static int hf_infiniband_PortInfo_P_KeyViolations = -1;
static int hf_infiniband_PortInfo_Q_KeyViolations = -1;
static int hf_infiniband_PortInfo_GUIDCap = -1;
static int hf_infiniband_PortInfo_ClientReregister = -1;
static int hf_infiniband_PortInfo_SubnetTimeOut = -1;
static int hf_infiniband_PortInfo_RespTimeValue = -1;
static int hf_infiniband_PortInfo_LocalPhyErrors = -1;
static int hf_infiniband_PortInfo_OverrunErrors = -1;
static int hf_infiniband_PortInfo_MaxCreditHint = -1;
static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1;

/* P_KeyTable */
static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1;
static int hf_infiniband_P_KeyTable_MembershipType = -1;
static int hf_infiniband_P_KeyTable_P_KeyBase = -1;

/* SLtoVLMappingTable */
static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1;
static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1;

/* VLArbitrationTable */
static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1;
static int hf_infiniband_VLArbitrationTable_VL = -1;
static int hf_infiniband_VLArbitrationTable_Weight = -1;

/* LinearForwardingTable */
static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1;
static int hf_infiniband_LinearForwardingTable_Port = -1;

/* RandomForwardingTable */
static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1;
static int hf_infiniband_RandomForwardingTable_LID = -1;
static int hf_infiniband_RandomForwardingTable_Valid = -1;
static int hf_infiniband_RandomForwardingTable_LMC = -1;
static int hf_infiniband_RandomForwardingTable_Port = -1;

/* MulticastForwardingTable */
static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1;
static int hf_infiniband_MulticastForwardingTable_PortMask = -1;

/* SMInfo */
static int hf_infiniband_SMInfo_GUID = -1;
static int hf_infiniband_SMInfo_SM_Key = -1;
static int hf_infiniband_SMInfo_ActCount = -1;
static int hf_infiniband_SMInfo_Priority = -1;
static int hf_infiniband_SMInfo_SMState = -1;

/* VendorDiag */
static int hf_infiniband_VendorDiag_NextIndex = -1;
static int hf_infiniband_VendorDiag_DiagData = -1;

/* LedInfo */
static int hf_infiniband_LedInfo_LedMask = -1;

/* LinkSpeedWidthPairsTable */
static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1;
static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1;
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1;
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1;
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1;

/* Attributes for Subnet Administration.
* Mostly we have "Records" here which are just structures of SM attributes.
* There are some unique attributes though that we will want to have a structure for. */

/* NodeRecord */
/* PortInfoRecord */
/* SLtoVLMappingTableRecord */
/* SwitchInfoRecord */
/* LinearForwardingTableRecord */
/* RandomForwardingTableRecord */
/* MulticastForwardingTableRecord */
/* VLArbitrationTableRecord */

static int hf_infiniband_SA_LID = -1;
static int hf_infiniband_SA_EndportLID = -1;
static int hf_infiniband_SA_PortNum = -1;
static int hf_infiniband_SA_InputPortNum = -1;
static int hf_infiniband_SA_OutputPortNum = -1;
static int hf_infiniband_SA_BlockNum_EightBit = -1;
static int hf_infiniband_SA_BlockNum_NineBit = -1;
static int hf_infiniband_SA_BlockNum_SixteenBit = -1;
static int hf_infiniband_SA_Position = -1;
static int hf_infiniband_SA_Index = -1;

/* InformInfoRecord */
static int hf_infiniband_InformInfoRecord_SubscriberGID = -1;
static int hf_infiniband_InformInfoRecord_Enum = -1;

/* InformInfo */
static int hf_infiniband_InformInfo_GID = -1;
static int hf_infiniband_InformInfo_LIDRangeBegin = -1;
static int hf_infiniband_InformInfo_LIDRangeEnd = -1;
static int hf_infiniband_InformInfo_IsGeneric = -1;
static int hf_infiniband_InformInfo_Subscribe = -1;
static int hf_infiniband_InformInfo_Type = -1;
static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1;
static int hf_infiniband_InformInfo_QPN = -1;
static int hf_infiniband_InformInfo_RespTimeValue = -1;
static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1;

/* LinkRecord */
static int hf_infiniband_LinkRecord_FromLID = -1;
static int hf_infiniband_LinkRecord_FromPort = -1;
static int hf_infiniband_LinkRecord_ToPort = -1;
static int hf_infiniband_LinkRecord_ToLID = -1;

/* ServiceRecord */
static int hf_infiniband_ServiceRecord_ServiceID = -1;
static int hf_infiniband_ServiceRecord_ServiceGID = -1;
static int hf_infiniband_ServiceRecord_ServiceP_Key = -1;
static int hf_infiniband_ServiceRecord_ServiceLease = -1;
static int hf_infiniband_ServiceRecord_ServiceKey = -1;
static int hf_infiniband_ServiceRecord_ServiceName = -1;
static int hf_infiniband_ServiceRecord_ServiceData = -1;

/* ServiceAssociationRecord */
static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1;
static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1;

/* PathRecord */
static int hf_infiniband_PathRecord_DGID = -1;
static int hf_infiniband_PathRecord_SGID = -1;
static int hf_infiniband_PathRecord_DLID = -1;
static int hf_infiniband_PathRecord_SLID = -1;
static int hf_infiniband_PathRecord_RawTraffic = -1;
static int hf_infiniband_PathRecord_FlowLabel = -1;
static int hf_infiniband_PathRecord_HopLimit = -1;
static int hf_infiniband_PathRecord_TClass = -1;
static int hf_infiniband_PathRecord_Reversible = -1;
static int hf_infiniband_PathRecord_NumbPath = -1;
static int hf_infiniband_PathRecord_P_Key = -1;
static int hf_infiniband_PathRecord_SL = -1;
static int hf_infiniband_PathRecord_MTUSelector = -1;
static int hf_infiniband_PathRecord_MTU = -1;
static int hf_infiniband_PathRecord_RateSelector = -1;
static int hf_infiniband_PathRecord_Rate = -1;
static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1;
static int hf_infiniband_PathRecord_PacketLifeTime = -1;
static int hf_infiniband_PathRecord_Preference = -1;

/* MCMemberRecord */
static int hf_infiniband_MCMemberRecord_MGID = -1;
static int hf_infiniband_MCMemberRecord_PortGID = -1;
static int hf_infiniband_MCMemberRecord_Q_Key = -1;
static int hf_infiniband_MCMemberRecord_MLID = -1;
static int hf_infiniband_MCMemberRecord_MTUSelector = -1;
static int hf_infiniband_MCMemberRecord_MTU = -1;
static int hf_infiniband_MCMemberRecord_TClass = -1;
static int hf_infiniband_MCMemberRecord_P_Key = -1;
static int hf_infiniband_MCMemberRecord_RateSelector = -1;
static int hf_infiniband_MCMemberRecord_Rate = -1;
static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1;
static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1;
static int hf_infiniband_MCMemberRecord_SL = -1;
static int hf_infiniband_MCMemberRecord_FlowLabel = -1;
static int hf_infiniband_MCMemberRecord_HopLimit = -1;
static int hf_infiniband_MCMemberRecord_Scope = -1;
static int hf_infiniband_MCMemberRecord_JoinState = -1;
static int hf_infiniband_MCMemberRecord_ProxyJoin = -1;

/* TraceRecord */
static int hf_infiniband_TraceRecord_GIDPrefix = -1;
static int hf_infiniband_TraceRecord_IDGeneration = -1;
static int hf_infiniband_TraceRecord_NodeType = -1;
static int hf_infiniband_TraceRecord_NodeID = -1;
static int hf_infiniband_TraceRecord_ChassisID = -1;
static int hf_infiniband_TraceRecord_EntryPortID = -1;
static int hf_infiniband_TraceRecord_ExitPortID = -1;
static int hf_infiniband_TraceRecord_EntryPort = -1;
static int hf_infiniband_TraceRecord_ExitPort = -1;

/* MultiPathRecord */
static int hf_infiniband_MultiPathRecord_RawTraffic = -1;
static int hf_infiniband_MultiPathRecord_FlowLabel = -1;
static int hf_infiniband_MultiPathRecord_HopLimit = -1;
static int hf_infiniband_MultiPathRecord_TClass = -1;
static int hf_infiniband_MultiPathRecord_Reversible = -1;
static int hf_infiniband_MultiPathRecord_NumbPath = -1;
static int hf_infiniband_MultiPathRecord_P_Key = -1;
static int hf_infiniband_MultiPathRecord_SL = -1;
static int hf_infiniband_MultiPathRecord_MTUSelector = -1;
static int hf_infiniband_MultiPathRecord_MTU = -1;
static int hf_infiniband_MultiPathRecord_RateSelector = -1;
static int hf_infiniband_MultiPathRecord_Rate = -1;
static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1;
static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1;
static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1;
static int hf_infiniband_MultiPathRecord_GIDScope = -1;
static int hf_infiniband_MultiPathRecord_SGIDCount = -1;
static int hf_infiniband_MultiPathRecord_DGIDCount = -1;
static int hf_infiniband_MultiPathRecord_SDGID = -1;

/* Notice */
static int hf_infiniband_Notice_IsGeneric = -1;
static int hf_infiniband_Notice_Type = -1;
static int hf_infiniband_Notice_ProducerTypeVendorID = -1;
static int hf_infiniband_Notice_TrapNumberDeviceID = -1;
static int hf_infiniband_Notice_IssuerLID = -1;
static int hf_infiniband_Notice_NoticeToggle = -1;
static int hf_infiniband_Notice_NoticeCount = -1;
static int hf_infiniband_Notice_DataDetails = -1;
static int hf_infiniband_Notice_IssuerGID = -1;
static int hf_infiniband_Notice_ClassTrapSpecificData = -1;

/* Notice DataDetails and ClassTrapSpecific Data for certain traps 
* Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */

/* Parse DataDetails for a given Trap */
static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber);

/* Traps 64,65,66,67 */
static int hf_infiniband_Trap_GIDADDR = -1;

/* Traps 68,69 */
/* DataDetails */
static int hf_infiniband_Trap_COMP_MASK = -1;
static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1;
/* ClassTrapSpecificData */
static int hf_infiniband_Trap_PATH_REC = -1;

/* Trap 128 */
static int hf_infiniband_Trap_LIDADDR = -1;

/* Trap 129, 130, 131 */
static int hf_infiniband_Trap_PORTNO = -1;

/* Trap 144 */
static int hf_infiniband_Trap_OtherLocalChanges = -1;
static int hf_infiniband_Trap_CAPABILITYMASK = -1;
static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1;
static int hf_infiniband_Trap_LinkWidthEnabledChange = -1;
static int hf_infiniband_Trap_NodeDescriptionChange = -1;

/* Trap 145 */
static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1;

/* Trap 256 */
static int hf_infiniband_Trap_DRSLID = -1;
static int hf_infiniband_Trap_METHOD = -1;
static int hf_infiniband_Trap_ATTRIBUTEID = -1;
static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1;
static int hf_infiniband_Trap_MKEY = -1;
static int hf_infiniband_Trap_DRNotice = -1;
static int hf_infiniband_Trap_DRPathTruncated = -1;
static int hf_infiniband_Trap_DRHopCount = -1;
static int hf_infiniband_Trap_DRNoticeReturnPath = -1;

/* Trap 257, 258 */
static int hf_infiniband_Trap_LIDADDR1 = -1;
static int hf_infiniband_Trap_LIDADDR2 = -1;
static int hf_infiniband_Trap_KEY = -1;
static int hf_infiniband_Trap_SL = -1;
static int hf_infiniband_Trap_QP1 = -1;
static int hf_infiniband_Trap_QP2 = -1;
static int hf_infiniband_Trap_GIDADDR1 = -1;
static int hf_infiniband_Trap_GIDADDR2 = -1;

/* Trap 259 */
static int hf_infiniband_Trap_DataValid = -1;
static int hf_infiniband_Trap_PKEY = -1;
static int hf_infiniband_Trap_SWLIDADDR = -1;

/* Trap Type/Descriptions for dissection */
static const value_string Trap_Description[]= {
	{ 64, " (Informational) <GIDADDR> is now in service"},
	{ 65, " (Informational) <GIDADDR> is out of service"},
	{ 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"},
	{ 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"},
	{ 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"},
	{ 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"},
	{ 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"},
	{ 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"},
	{ 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"},
	{ 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"},
	{ 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
	{ 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified.  New value is <SYSTEMIMAGEGUID>"},
	{ 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
	{ 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
	{ 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
	{ 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"},
	{ 0, NULL}
};




/* MAD Management Classes
* Classes from the Common MAD Header
*
*      Management Class Name		Class Description
* ------------------------------------------------------------------------------------------------------------ */
#define SUBN_LID_ROUTED 0x01		/* Subnet Management LID Route */
#define SUBN_DIRECTED_ROUTE 0x81	/* Subnet Management Directed Route */
#define SUBNADMN 0x03				/* Subnet Administration */
#define PERF 0x04					/* Performance Management */
#define BM 0x05						/* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
#define DEV_MGT 0x06				/* Device Management */
#define COM_MGT 0x07				/* Communications Management */
#define SNMP 0x08					/* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */
#define VENDOR_1_START 0x09			/* Start of first Vendor Specific Range */
#define VENDOR_1_END 0x0F			/* End of first Vendor Specific Range */
#define VENDOR_2_START 0x30			/* Start of second Vendor Specific Range */
#define VENDOR_2_END 0x4F			/* End of the second Vendor Specific Range */
#define APPLICATION_START 0x10		/* Start of Application Specific Range */
#define APPLICATION_END 0x2F		/* End of Application Specific Range */

/* Link Next Header Values */
#define IBA_GLOBAL 3
#define IBA_LOCAL  2
#define IP_NON_IBA 1
#define RAW        0

/* OpCodeValues
* Code Bits [7-5] Connection Type 
*           [4-0] Message Type

* Reliable Connection (RC)
* [7-5] = 000 */
#define RC_SEND_FIRST					0 /*0x00000000 */
#define RC_SEND_MIDDLE					1 /*0x00000001 */
#define RC_SEND_LAST					2 /*0x00000010 */
#define RC_SEND_LAST_IMM				3 /*0x00000011 */
#define RC_SEND_ONLY					4 /*0x00000100 */
#define RC_SEND_ONLY_IMM				5 /*0x00000101 */
#define RC_RDMA_WRITE_FIRST				6 /*0x00000110 */
#define RC_RDMA_WRITE_MIDDLE			7 /*0x00000111 */
#define RC_RDMA_WRITE_LAST				8 /*0x00001000 */
#define RC_RDMA_WRITE_LAST_IMM			9 /*0x00001001 */
#define RC_RDMA_WRITE_ONLY				10 /*0x00001010 */
#define RC_RDMA_WRITE_ONLY_IMM			11 /*0x00001011 */
#define RC_RDMA_READ_REQUEST			12 /*0x00001100 */
#define RC_RDMA_READ_RESPONSE_FIRST		13 /*0x00001101 */
#define RC_RDMA_READ_RESPONSE_MIDDLE	14 /*0x00001110 */
#define RC_RDMA_READ_RESPONSE_LAST		15 /*0x00001111 */
#define RC_RDMA_READ_RESPONSE_ONLY		16 /*0x00010000 */
#define RC_ACKNOWLEDGE					17 /*0x00010001 */
#define RC_ATOMIC_ACKNOWLEDGE			18 /*0x00010010 */
#define RC_CMP_SWAP						19 /*0x00010011 */
#define RC_FETCH_ADD					20 /*0x00010100 */
#define RC_SEND_LAST_INVAL				22 /*0x00010110 */
#define RC_SEND_ONLY_INVAL				23 /*0x00010111 */

/* Reliable Datagram (RD)
* [7-5] = 010 */
#define RD_SEND_FIRST					64 /*0x01000000 */
#define RD_SEND_MIDDLE					65 /*0x01000001 */
#define RD_SEND_LAST					66 /*0x01000010 */
#define RD_SEND_LAST_IMM				67 /*0x01000011 */
#define RD_SEND_ONLY					68 /*0x01000100 */
#define RD_SEND_ONLY_IMM				69 /*0x01000101 */
#define RD_RDMA_WRITE_FIRST				70 /*0x01000110 */
#define RD_RDMA_WRITE_MIDDLE			71 /*0x01000111 */
#define RD_RDMA_WRITE_LAST				72 /*0x01001000 */
#define RD_RDMA_WRITE_LAST_IMM			73 /*0x01001001 */
#define RD_RDMA_WRITE_ONLY				74 /*0x01001010 */
#define RD_RDMA_WRITE_ONLY_IMM			75 /*0x01001011 */
#define RD_RDMA_READ_REQUEST			76 /*0x01001100 */
#define RD_RDMA_READ_RESPONSE_FIRST		77 /*0x01001101 */
#define RD_RDMA_READ_RESPONSE_MIDDLE	78 /*0x01001110 */
#define RD_RDMA_READ_RESPONSE_LAST		79 /*0x01001111 */
#define RD_RDMA_READ_RESPONSE_ONLY		80 /*0x01010000 */
#define RD_ACKNOWLEDGE					81 /*0x01010001 */
#define RD_ATOMIC_ACKNOWLEDGE			82 /*0x01010010 */
#define RD_CMP_SWAP						83 /*0x01010011 */
#define RD_FETCH_ADD					84 /*0x01010100 */
#define RD_RESYNC						85 /*0x01010101 */

/* Unreliable Datagram (UD)
* [7-5] = 011 */
#define UD_SEND_ONLY					100 /*0x01100100 */
#define UD_SEND_ONLY_IMM				101 /*0x01100101 */

/* Unreliable Connection (UC)
* [7-5] = 001 */
#define UC_SEND_FIRST					32 /*0x00100000 */
#define UC_SEND_MIDDLE					33 /*0x00100001 */
#define UC_SEND_LAST					34 /*0x00100010 */
#define UC_SEND_LAST_IMM				35 /*0x00100011 */
#define UC_SEND_ONLY					36 /*0x00100100 */
#define UC_SEND_ONLY_IMM				37 /*0x00100101 */
#define UC_RDMA_WRITE_FIRST				38 /*0x00100110 */
#define UC_RDMA_WRITE_MIDDLE			39 /*0x00100111 */
#define UC_RDMA_WRITE_LAST				40 /*0x00101000 */
#define UC_RDMA_WRITE_LAST_IMM			41 /*0x00101001 */
#define UC_RDMA_WRITE_ONLY				42 /*0x00101010 */
#define UC_RDMA_WRITE_ONLY_IMM			43 /*0x00101011 */

static value_string OpCodeMap[] =
{
	{ RC_SEND_FIRST, "RC Send First " },
	{ RC_SEND_MIDDLE, "RC Send Middle "},
	{ RC_SEND_LAST, "RC Send Last " },
	{ RC_SEND_LAST_IMM, "RC Send Last Immediate "},
	{ RC_SEND_ONLY, "RC Send Only "},
	{ RC_SEND_ONLY_IMM, "RC Send Only Immediate "},
	{ RC_RDMA_WRITE_FIRST, "RC RDMA Write First " },
	{ RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "},
	{ RC_RDMA_WRITE_LAST, "RC RDMA Write Last "},
	{ RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " },
	{ RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " },
	{ RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "},
	{ RC_RDMA_READ_REQUEST,	 "RC RDMA Read Request " },
	{ RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " },
	{ RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "},
	{ RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " },
	{ RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "},
	{ RC_ACKNOWLEDGE, "RC Acknowledge " },
	{ RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " },
	{ RC_CMP_SWAP, "RC Compare Swap " },
	{ RC_FETCH_ADD, "RC Fetch Add "},
	{ RC_SEND_LAST_INVAL, "RC Send Last Invalidate "},
	{ RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " },


	{ RD_SEND_FIRST, "RD Send First "},
	{ RD_SEND_MIDDLE,"RD Send Middle " },
	{ RD_SEND_LAST,	"RD Send Last "},
	{ RD_SEND_LAST_IMM,	"RD Last Immediate " },
	{ RD_SEND_ONLY,"RD Send Only "},
	{ RD_SEND_ONLY_IMM,"RD Send Only Immediate "},
	{ RD_RDMA_WRITE_FIRST,"RD RDMA Write First "},
	{ RD_RDMA_WRITE_MIDDLE,	"RD RDMA Write Middle "},
	{ RD_RDMA_WRITE_LAST,"RD RDMA Write Last "},
	{ RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "},
	{ RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "},
	{ RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "},
	{ RD_RDMA_READ_REQUEST,"RD RDMA Read Request "},
	{ RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "},
	{ RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "},
	{ RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "},
	{ RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "},
	{ RD_ACKNOWLEDGE,"RD Acknowledge "},
	{ RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "},
	{ RD_CMP_SWAP,"RD Compare Swap "},
	{ RD_FETCH_ADD,	"RD Fetch Add "},
	{ RD_RESYNC,"RD RESYNC "},


	{ UD_SEND_ONLY,	"UD Send Only "},
	{ UD_SEND_ONLY_IMM,	"UD Send Only Immediate "},


	{ UC_SEND_FIRST,"UC Send First "},
	{ UC_SEND_MIDDLE,"UC Send Middle "},
	{ UC_SEND_LAST,"UC Send Last "},
	{ UC_SEND_LAST_IMM,"UC Send Last Immediate "},
	{ UC_SEND_ONLY,"UC Send Only "},
	{ UC_SEND_ONLY_IMM,"UC Send Only Immediate "},
	{ UC_RDMA_WRITE_FIRST,"UC RDMA Write First"},
	{ UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "},
	{ UC_RDMA_WRITE_LAST,"UC RDMA Write Last "},
	{ UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "},
	{ UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "},
	{ UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "},
	{ 0, NULL}

};



/* Header Ordering Based on OPCODES
* These are simply an enumeration of the possible header combinations defined by the IB Spec.
* These enumerations 
* #DEFINE [HEADER_ORDER]         [ENUM] 
* __________________________________ */
#define RDETH_DETH_PAYLD			0
/* __________________________________ */
#define RDETH_DETH_RETH_PAYLD		1
/* __________________________________ */
#define RDETH_DETH_IMMDT_PAYLD		2
/* __________________________________ */
#define RDETH_DETH_RETH_IMMDT_PAYLD 3
/* __________________________________ */
#define RDETH_DETH_RETH				4
/* __________________________________ */
#define RDETH_AETH_PAYLD			5
/* __________________________________ */
#define RDETH_PAYLD					6
/* __________________________________ */
#define RDETH_AETH					7
/* __________________________________ */
#define RDETH_AETH_ATOMICACKETH		8
/* __________________________________ */
#define RDETH_DETH_ATOMICETH		9
/* ___________________________________ */
#define RDETH_DETH					10
/* ___________________________________ */
#define DETH_PAYLD					11
/* ___________________________________ */
#define DETH_IMMDT_PAYLD			12
/* ___________________________________ */
#define PAYLD						13
/* ___________________________________ */
#define IMMDT_PAYLD					14
/* ___________________________________ */
#define RETH_PAYLD					15
/* ___________________________________ */
#define RETH_IMMDT_PAYLD			16
/* ___________________________________ */
#define RETH						17
/* ___________________________________ */
#define AETH_PAYLD					18
/* ___________________________________ */
#define AETH						19
/* ___________________________________ */
#define AETH_ATOMICACKETH			20
/* ___________________________________ */
#define ATOMICETH					21
/* ___________________________________ */
#define IETH_PAYLD					22
/* ___________________________________ */


/* Array of all availavle OpCodes to make matching a bit easier.
* The OpCodes dictate the header sequence following in the packet.
* These arrays tell the dissector which headers must be decoded for the given OpCode. */
static guint32 opCode_RDETH_DETH_ATOMICETH[] = {
 RD_CMP_SWAP,
 RD_FETCH_ADD
};
static guint32 opCode_IETH_PAYLD[] = {
 RC_SEND_LAST_INVAL,
 RC_SEND_ONLY_INVAL
};
static guint32 opCode_ATOMICETH[] = {
 RC_CMP_SWAP,
 RC_FETCH_ADD
};
static guint32 opCode_RDETH_DETH_RETH_PAYLD[] = {
 RD_RDMA_WRITE_FIRST,
 RD_RDMA_WRITE_ONLY
};
static guint32 opCode_RETH_IMMDT_PAYLD[] = {
 RC_RDMA_WRITE_ONLY_IMM,
 UC_RDMA_WRITE_ONLY_IMM
};
static guint32 opCode_RDETH_DETH_IMMDT_PAYLD[] = {
 RD_SEND_LAST_IMM,
 RD_SEND_ONLY_IMM,
 RD_RDMA_WRITE_LAST_IMM
};

static guint32 opCode_RDETH_AETH_PAYLD[] = {
 RD_RDMA_READ_RESPONSE_FIRST,
 RD_RDMA_READ_RESPONSE_LAST,
 RD_RDMA_READ_RESPONSE_ONLY
};
static guint32 opCode_AETH_PAYLD[] = {
 RC_RDMA_READ_RESPONSE_FIRST,
 RC_RDMA_READ_RESPONSE_LAST,
 RC_RDMA_READ_RESPONSE_ONLY
};
static guint32 opCode_RETH_PAYLD[] = {
 RC_RDMA_WRITE_FIRST,
 RC_RDMA_WRITE_ONLY,
 UC_RDMA_WRITE_FIRST,
 UC_RDMA_WRITE_ONLY
};

static guint32 opCode_RDETH_DETH_PAYLD[] = {
 RD_SEND_FIRST,
 RD_SEND_MIDDLE,
 RD_SEND_LAST,
 RD_SEND_ONLY,
 RD_RDMA_WRITE_MIDDLE,
 RD_RDMA_WRITE_LAST
};

static guint32 opCode_IMMDT_PAYLD[] = {
 RC_SEND_LAST_IMM,
 RC_SEND_ONLY_IMM,
 RC_RDMA_WRITE_LAST_IMM,
 UC_SEND_LAST_IMM,
 UC_SEND_ONLY_IMM,
 UC_RDMA_WRITE_LAST_IMM
};

static guint32 opCode_PAYLD[] = {
 RC_SEND_FIRST,
 RC_SEND_MIDDLE,
 RC_SEND_LAST,
 RC_SEND_ONLY,
 RC_RDMA_WRITE_MIDDLE,
 RC_RDMA_WRITE_LAST,
 RC_RDMA_READ_RESPONSE_MIDDLE,
 UC_SEND_FIRST,
 UC_SEND_MIDDLE,
 UC_SEND_LAST,
 UC_SEND_ONLY,
 UC_RDMA_WRITE_MIDDLE,
 UC_RDMA_WRITE_LAST
};

/* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
*  We can just decode it directly

* static guint32 opCode_DETH_IMMDT_PAYLD[] = {
* UD_SEND_ONLY_IMM
* };
* static guint32 opCode_DETH_PAYLD[] = {
* UD_SEND_ONLY
* };
* static guint32 opCode_RDETH_DETH[] = {
* RD_RESYNC
* };
* static guint32 opCode_RDETH_DETH_RETH[] = {
* RD_RDMA_READ_REQUEST
* };
* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
* RD_RDMA_WRITE_ONLY_IMM
* };
* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = {
* RD_ATOMIC_ACKNOWLEDGE
* };
* static guint32 opCode_RDETH_AETH[] = {
* RD_ACKNOWLEDGE
* };
* static guint32 opCode_RDETH_PAYLD[] = {
* RD_RDMA_READ_RESPONSE_MIDDLE
* };
* static guint32 opCode_AETH_ATOMICACKETH[] = {
* RC_ATOMIC_ACKNOWLEDGE
* };
* static guint32 opCode_RETH[] = {
* RC_RDMA_READ_REQUEST
* };
* static guint32 opCode_AETH[] = {
* RC_ACKNOWLEDGE
* }; */


/* Field dissector structures.
* For reserved fields, reservedX denotes the reserved field is X bits in length.
* e.g. reserved2 is a reserved field 2 bits in length.
* The third parameter is a filter string associated for this field.
* So for instance, to filter packets for a given virtual lane,
* The filter (infiniband.LRH.vl == 3) or something similar would be used. */

static hf_register_info hf[] = {
	
	/* Local Route Header (LRH) */
	{&hf_infiniband_LRH,
	{"Local Route Header", "infiniband.lrh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_virtual_lane,
	{"Virtual Lane", "infiniband.lrh.vl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_link_version,
	{"Link Version", "infiniband.lrh.lver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_service_level,
	{"Service Level", "infiniband.lrh.sl", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_reserved2,
	{"Reserved (2 bits)", "infiniband.lrh.reserved2", FT_UINT8, BASE_DEC, NULL, 0x0C, NULL, HFILL}
	},
	{&hf_infiniband_link_next_header,
	{"Link Next Header", "infiniband.lrh.lnh", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
	},
	{&hf_infiniband_destination_local_id,
	{"Destination Local ID", "infiniband.lrh.dlid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved5,
	{"Reserved (5 bits)", "infiniband.lrh.reserved5", FT_UINT16, BASE_DEC, NULL, 0xF800, NULL, HFILL}
	},
	{&hf_infiniband_packet_length,
	{"Packet Length", "infiniband.lrh.pktlen", FT_UINT16, BASE_DEC, NULL, 0x07FF, NULL, HFILL}
	},
	{&hf_infiniband_source_local_id,
	{"Source Local ID", "infiniband.lrh.slid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Global Route Header (GRH) */
	{&hf_infiniband_GRH,
	{"Global Route Header", "infiniband.grh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ip_version,
	{"IP Version", "infiniband.grh.ipver", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_traffic_class,
	{"Traffic Class", "infiniband.grh.tclass", FT_UINT16, BASE_DEC, NULL, 0x0FF0, NULL, HFILL}
	},
	{&hf_infiniband_flow_label,
	{"Flow Label", "infiniband.grh.flowlabel", FT_UINT32, BASE_DEC, NULL, 0x000FFFFF, NULL, HFILL}
	},
	{&hf_infiniband_payload_length,
	{"Payload Length", "infiniband.grh.paylen", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_next_header,
	{"Next Header", "infiniband.grh.nxthdr", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_hop_limit,
	{"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_source_gid,
	{"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_destination_gid,
	{"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Base Transport Header (BTH) */
	{&hf_infiniband_BTH,
	{"Base Transport Header", "infiniband.bth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_opcode,
	{"Opcode", "infiniband.bth.opcode", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_solicited_event,
	{"Solicited Event", "infiniband.bth.se", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_migreq,
	{"MigReq", "infiniband.bth.m", FT_BOOLEAN, BASE_DEC, NULL, 0x40, NULL, HFILL}
	},
	{&hf_infiniband_pad_count,
	{"Pad Count", "infiniband.bth.padcnt", FT_UINT8, BASE_DEC, NULL, 0x30, NULL, HFILL}
	},
	{&hf_infiniband_transport_header_version,
	{"Header Version", "infiniband.bth.tver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_partition_key,
	{"Partition Key", "infiniband.bth.p_key", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved8,
	{"Reserved (8 bits)", "infiniband.bth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_destination_qp,
	{"Destination Queue Pair", "infiniband.bth.destqp", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_acknowledge_request,
	{"Acknowledge Request", "infiniband.bth.a", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_reserved7,
	{"Reserved (7 bits)", "infiniband.bth.reserved7", FT_UINT8, BASE_DEC, NULL, 0x7F, NULL, HFILL}
	},
	{&hf_infiniband_packet_sequence_number,
	{"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Raw Header (RWH) */
	{&hf_infiniband_RWH,
	{"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved16_RWH,
	{"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_etype,
	{"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
	},

	/* Reliable Datagram Extended Transport Header (RDETH) */
	{&hf_infiniband_RDETH,
	{"Reliable Datagram Extended Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved8_RDETH,
	{"Reserved (8 bits)", "infiniband.rdeth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ee_context,
	{"E2E Context", "infiniband.rdeth.eecnxt", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Datagram Extended Transport Header (DETH) */
	{&hf_infiniband_DETH,
	{"Datagram Extended Transport Header", "infiniband.deth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_queue_key,
	{"Queue Key", "infiniband.deth.q_key", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved8_DETH,
	{"Reserved (8 bits)", "infiniband.deth.reserved8", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_source_qp,
	{"Source Queue Pair", "infiniband.deth.srcqp", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* RDMA Extended Transport Header (RETH) */
	{&hf_infiniband_RETH,
	{"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_virtual_address,
	{"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_remote_key,
	{"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_dma_length,
	{"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Atomic Extended Transport Header (AtomicETH) */
	{&hf_infiniband_AtomicETH,
	{"Atomic Extended Transport Header", "infiniband.atomiceth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_virtual_address_AtomicETH,
	{"Virtual Address", "infiniband.atomiceth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_remote_key_AtomicETH,
	{"Remote Key", "infiniband.atomiceth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_swap_or_add_data,
	{"Swap (Or Add) Data", "infiniband.atomiceth.swapdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_compare_data,
	{"Compare Data", "infiniband.atomiceth.cmpdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* ACK Extended Transport Header (AETH) */
	{&hf_infiniband_AETH,
	{"ACK Extended Transport Header", "infiniband.aeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_syndrome,
	{"Syndrome", "infiniband.aeth.syndrome", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_message_sequence_number,
	{"Message Sequence Number", "infiniband.aeth.msn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	
	/* Atomic ACK Extended Transport Header (AtomicAckETH) */
	{&hf_infiniband_AtomicAckETH,
	{"Atomic ACK Extended Transport Header", "infiniband.atomicacketh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_original_remote_data,
	{"Original Remote Data", "infiniband.atomicacketh.origremdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
	},
	/* Immediate Extended Transport Header (ImmDT) */
	{&hf_infiniband_IMMDT,
	{"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},

	/* Invalidate Extended Transport Header (IETH) */
	{&hf_infiniband_IETH,
	{"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},

	/* Payload */
	{&hf_infiniband_payload,
	{"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_invariant_crc,
	{"Invariant CRC", "infiniband.invariant.crc", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_variant_crc,
	{"Variant CRC", "infiniband.variant.crc", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_raw_data,
	{"Raw Data", "infiniband.rawdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Unknown or Vendor Specific */
	{&hf_infiniband_vendor,
	{"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},

	/* MAD Base Header */
	{&hf_infiniband_MAD,
	{"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_base_version,
	{"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_mgmt_class,
	{"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_class_version,
	{"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved1,
	{"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_method,
	{"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
	},
	{&hf_infiniband_status,
	{"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_class_specific,
	{"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_transaction_id,
	{"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_attribute_id,
	{"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved16,
	{"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_attribute_modifier,
	{"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_data,
	{"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* RMPP Header */
	{&hf_infiniband_RMPP,
	{"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_version,
	{"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_type,
	{"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_r_resp_time,
	{"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_flags,
	{"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_status,
	{"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_data1,
	{"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_rmpp_data2,
	{"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* RMPP Data */
	{&hf_infiniband_RMPP_DATA,
	{"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_segment_number,
	{"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_payload_length32,
	{"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_transferred_data,
	{"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* RMPP ACK */
	{&hf_infiniband_new_window_last,
	{"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved220,
	{"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* RMPP ABORT/STOP */
	{&hf_infiniband_optional_extended_error_data,
	{"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* SMP Data (LID Routed) */
	{&hf_infiniband_SMP_LID,
	{"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_m_key,
	{"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_smp_data,
	{"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved1024,
	{"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved256,
	{"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* SMP Data Directed Route */
	{&hf_infiniband_SMP_DIRECTED,
	{"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_smp_status,
	{"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_hop_pointer,
	{"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_hop_count,
	{"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_dr_slid,
	{"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_dr_dlid,
	{"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_reserved28,
	{"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_d,
	{"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
	},
	{&hf_infiniband_initial_path,
	{"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_return_path,
	{"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* SA MAD Header */
	{&hf_infiniband_SA,
	{"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_sm_key,
	{"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_attribute_offset,
	{"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_component_mask,
	{"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_subnet_admin_data,
	{"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* NodeDescription */
	{&hf_infiniband_NodeDescription_NodeString,
	{"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* NodeInfo */
	{&hf_infiniband_NodeInfo_BaseVersion,
	{"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_ClassVersion,
	{"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_NodeType,
	{"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_NumPorts,
	{"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_SystemImageGUID,
	{"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_NodeGUID,
	{"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_PortGUID,
	{"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_PartitionCap,
	{"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_DeviceID,
	{"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_Revision,
	{"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_LocalPortNum,
	{"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_NodeInfo_VendorID,
	{"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* SwitchInfo */
	{&hf_infiniband_SwitchInfo_LinearFDBCap,
	{"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_RandomFDBCap,
	{"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_MulticastFDBCap,
	{"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_LinearFDBTop,
	{"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_DefaultPort,
	{"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,
	{"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,
	{"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_LifeTimeValue,
	{"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_PortStateChange,
	{"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming,
	{"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_LIDsPerPort,
	{"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_PartitionEnforcementCap,
	{"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_InboundEnforcementCap,
	{"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_OutboundEnforcementCap,
	{"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_FilterRawInboundCap,
	{"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_FilterRawOutboundCap,
	{"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
	},
	{&hf_infiniband_SwitchInfo_EnhancedPortZero,
	{"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
	},
	/* GUIDInfo */
	{&hf_infiniband_GUIDInfo_GUIDBlock,
	{"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_GUIDInfo_GUID,
	{"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* PortInfo */
	{&hf_infiniband_PortInfo_M_Key,
	{"M_Key", "infiniband.portinfo.m_key",						FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_GidPrefix,
	{"GidPrefix", "infiniband.portinfo.guid",					FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LID,
	{"LID", "infiniband.portinfo.lid",							FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_MasterSMLID,
	{"MasterSMLID", "infiniband.portinfo.mastersmlid",			FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask,
	{"CapabilityMask", "infiniband.portinfo.capabilitymask",	FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	
	/* Capability Mask Flags */
	{&hf_infiniband_PortInfo_CapabilityMask_SM,
	{"SM", "infiniband.portinfo.capabilitymask.issm",							FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,
	{"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported",	FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_TrapSupported,
	{"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported",		FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,
	{"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported",					FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,
	{"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported",	FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,
	{"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported",	FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,
	{"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram",					FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,
	{"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram",					FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,
	{"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported",		FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_SMdisabled,
	{"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled",					FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,
	{"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported",							FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,
	{"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported",	FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,
	{"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported",		FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,
	{"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported",			FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,
	{"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported",						FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,
	{"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported",	FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,
	{"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported",				FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,
	{"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported",					FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,
	{"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported",			FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,
	{"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported",						FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,
	{"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported",			FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,
	{"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported",				FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,
	{"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported",		FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,
	{"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported",	FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
	},
	/* End Capability Mask Flags */

	{&hf_infiniband_PortInfo_DiagCode,
	{"DiagCode", "infiniband.portinfo.diagcode",				FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_M_KeyLeasePeriod,
	{"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod",	FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LocalPortNum,
	{"LocalPortNum", "infiniband.portinfo.localportnum",				FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkWidthEnabled,
	{"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkWidthSupported,
	{"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported",	FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkWidthActive,
	{"LinkWidthActive", "infiniband.portinfo.linkwidthactive",			FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkSpeedSupported,
	{"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported",	FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_PortState,
	{"PortState", "infiniband.portinfo.portstate",						FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_PortPhysicalState,
	{"PortPhysicalState", "infiniband.portinfo.portphysicalstate",		FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkDownDefaultState,
	{"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_M_KeyProtectBits,
	{"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LMC,
	{"LMC", "infiniband.portinfo.lmc",								FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkSpeedActive,
	{"LinkSpeedActive", "infiniband.portinfo.linkspeedactive",		FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkSpeedEnabled,
	{"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled",	FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_NeighborMTU,
	{"NeighborMTU", "infiniband.portinfo.neighbormtu",				FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_MasterSMSL,
	{"MasterSMSL", "infiniband.portinfo.mastersmsl",				FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_VLCap,
	{"VLCap", "infiniband.portinfo.vlcap",							FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_InitType,
	{"InitType", "infiniband.portinfo.inittype",					FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_VLHighLimit,
	{"VLHighLimit", "infiniband.portinfo.vlhighlimit",				FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_VLArbitrationHighCap,
	{"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_VLArbitrationLowCap,
	{"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap",	FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_InitTypeReply,
	{"InitTypeReply", "infiniband.portinfo.inittypereply",				FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_MTUCap,
	{"MTUCap", "infiniband.portinfo.mtucap",							FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_VLStallCount,
	{"VLStallCount", "infiniband.portinfo.vlstallcount",				FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_HOQLife,
	{"HOQLife", "infiniband.portinfo.hoqlife",					FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_OperationalVLs,
	{"OperationalVLs", "infiniband.portinfo.operationalvls",	FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_PartitionEnforcementInbound,
	{"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound",	FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_PartitionEnforcementOutbound,
	{"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_FilterRawInbound,
	{"FilterRawInbound", "infiniband.portinfo.filterrawinbound",	FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_FilterRawOutbound,
	{"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound",	FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_M_KeyViolations,
	{"M_KeyViolations", "infiniband.portinfo.m_keyviolations",	FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_P_KeyViolations,
	{"P_KeyViolations", "infiniband.portinfo.p_keyviolations",	FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_Q_KeyViolations,
	{"Q_KeyViolations", "infiniband.portinfo.q_keyviolations",	FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_GUIDCap,
	{"GUIDCap", "infiniband.portinfo.guidcap",					FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_ClientReregister,
	{"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_SubnetTimeOut,
	{"SubnetTimeOut", "infiniband.portinfo.subnettimeout",		FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_RespTimeValue,
	{"RespTimeValue", "infiniband.portinfo.resptimevalue",		FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LocalPhyErrors,
	{"LocalPhyErrors", "infiniband.portinfo.localphyerrors",	FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_OverrunErrors,
	{"OverrunErrors", "infiniband.portinfo.overrunerrors",		FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_MaxCreditHint,
	{"MaxCreditHint", "infiniband.portinfo.maxcredithint",		FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PortInfo_LinkRoundTripLatency,
	{"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* P_KeyTable */
	{&hf_infiniband_P_KeyTable_P_KeyTableBlock,
	{"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_P_KeyTable_MembershipType,
	{"MembershipType", "infiniband.p_keytable.membershiptype",	FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_P_KeyTable_P_KeyBase,
	{"P_KeyBase", "infiniband.p_keytable.p_keybase",			FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
	},
	/* SLtoVLMappingTable */
	{&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,
	{"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits",			FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,
	{"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits",			FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	/* VLArbitrationTable */
	{&hf_infiniband_VLArbitrationTable_VLWeightPairs,
	{"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs",	FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
	},
	{&hf_infiniband_VLArbitrationTable_VL,
	{"VL", "infiniband.vlarbitrationtable.vl",							FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_VLArbitrationTable_Weight,
	{"Weight", "infiniband.vlarbitrationtable.weight",					FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* LinearForwardingTable */
	{&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock,
	{"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock",	FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_LinearForwardingTable_Port,
	{"Port", "infiniband.linearforwardingtable.port",							FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* RandomForwardingTable */
	{&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock,
	{"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock",			FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
	},
	{&hf_infiniband_RandomForwardingTable_LID,
	{"LID", "infiniband.randomforwardingtable.lid",			FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_RandomForwardingTable_Valid,
	{"Valid", "infiniband.randomforwardingtable.valid",			FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_RandomForwardingTable_LMC,
	{"LMC", "infiniband.randomforwardingtable.lmc",			FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL}
	},
	{&hf_infiniband_RandomForwardingTable_Port,
	{"Port", "infiniband.randomforwardingtable.port",			FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* MulticastForwardingTable */
	{&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock ,
	{"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MulticastForwardingTable_PortMask,
	{"PortMask", "infiniband.multicastforwardingtable.portmask",			FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* SMInfo */
	{&hf_infiniband_SMInfo_GUID,
	{"GUID", "infiniband.sminfo.guid",			FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SMInfo_SM_Key,
	{"SM_Key", "infiniband.sminfo.sm_key",		FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SMInfo_ActCount,
	{"ActCount", "infiniband.sminfo.actcount",	FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SMInfo_Priority,
	{"Priority", "infiniband.sminfo.priority",	FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_SMInfo_SMState,
	{"SMState", "infiniband.sminfo.smstate",	FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	/* VendorDiag */
	{&hf_infiniband_VendorDiag_NextIndex,
	{"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_VendorDiag_DiagData,
	{"DiagData", "infiniband.vendordiag.diagdata",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* LedInfo */
	{&hf_infiniband_LedInfo_LedMask,
	{"LedMask", "infiniband.ledinfo.ledmask",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},	
	/* LinkSpeedWidthPairsTable */
	{&hf_infiniband_LinkSpeedWidthPairsTable_NumTables,
	{"NumTables", "infiniband.linkspeedwidthpairstable.numtables",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_LinkSpeedWidthPairsTable_PortMask,
	{"PortMask", "infiniband.linkspeedwidthpairstable.portmask",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},	
	{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,
	{"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},	
	{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,
	{"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},	
	{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,
	{"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},	
	/* NodeRecord */
	/* PortInfoRecord */
	/* SLtoVLMappingTableRecord */
	/* SwitchInfoRecord */
	/* LinearForwardingTableRecord */
	/* RandomForwardingTableRecord */
	/* MulticastForwardingTableRecord */
	/* VLArbitrationTableRecord */
	{&hf_infiniband_SA_LID,
	{"LID", "infiniband.sa.lid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_EndportLID,
	{"EndportLID", "infiniband.sa.endportlid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_PortNum,
	{"PortNum", "infiniband.sa.portnum",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_InputPortNum ,
	{"InputPortNum ", "infiniband.sa.inputportnum",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_OutputPortNum,
	{"OutputPortNum", "infiniband.sa.outputportnum",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_BlockNum_EightBit,
	{"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_BlockNum_NineBit,
	{"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit",	 FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
	},
	{&hf_infiniband_SA_BlockNum_SixteenBit,
	{"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_SA_Position,
	{"Position", "infiniband.sa.position",	 FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_SA_Index,
	{"Index", "infiniband.sa.index",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* InformInfoRecord */
	{&hf_infiniband_InformInfoRecord_SubscriberGID,
	{"SubscriberGID", "infiniband.informinforecord.subscribergid",	 FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfoRecord_Enum,
	{"Enum", "infiniband.informinforecord.enum",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* InformInfo */
	{&hf_infiniband_InformInfo_GID,
	{"GID", "infiniband.informinfo.gid",					FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_LIDRangeBegin,
	{"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_LIDRangeEnd,
	{"LIDRangeEnd", "infiniband.informinfo.lidrangeend",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_IsGeneric,
	{"IsGeneric", "infiniband.informinfo.isgeneric",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_Subscribe,
	{"Subscribe", "infiniband.informinfo.subscribe",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_Type,
	{"Type", "infiniband.informinfo.type",				FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_TrapNumberDeviceID,
	{"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_QPN,
	{"QPN", "infiniband.informinfo.qpn",	 FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_RespTimeValue,
	{"RespTimeValue", "infiniband.informinfo.resptimevalue",	 FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
	},
	{&hf_infiniband_InformInfo_ProducerTypeVendorID,
	{"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid",	 FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* LinkRecord */
	{&hf_infiniband_LinkRecord_FromLID,
	{"FromLID", "infiniband.linkrecord.fromlid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_LinkRecord_FromPort,
	{"FromPort", "infiniband.linkrecord.fromport",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_LinkRecord_ToPort,
	{"ToPort", "infiniband.linkrecord.toport",	 FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_LinkRecord_ToLID,
	{"ToLID", "infiniband.linkrecord.tolid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* ServiceRecord */
	{&hf_infiniband_ServiceRecord_ServiceID,
	{"ServiceID", "infiniband.linkrecord.serviceid",	 FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceGID,
	{"ServiceGID", "infiniband.linkrecord.servicegid",	 FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceP_Key,
	{"ServiceP_Key", "infiniband.linkrecord.servicep_key",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceLease,
	{"ServiceLease", "infiniband.linkrecord.servicelease",	 FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceKey,
	{"ServiceKey", "infiniband.linkrecord.servicekey",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceName,
	{"ServiceName", "infiniband.linkrecord.servicename",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceRecord_ServiceData,
	{"ServiceData", "infiniband.linkrecord.servicedata",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* ServiceAssociationRecord */
	{&hf_infiniband_ServiceAssociationRecord_ServiceKey,
	{"ServiceKey", "infiniband.serviceassociationrecord.servicekey",	 FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_ServiceAssociationRecord_ServiceName,
	{"ServiceName", "infiniband.serviceassociationrecord.servicename",	 FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* PathRecord */
	{&hf_infiniband_PathRecord_DGID,
	{"DGID", "infiniband.pathrecord.dgid",	 FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_SGID,
	{"SGID", "infiniband.pathrecord.sgid",	 FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_DLID,
	{"DLID", "infiniband.pathrecord.dlid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_SLID,
	{"SLID", "infiniband.pathrecord.slid",	 FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_RawTraffic,
	{"RawTraffic", "infiniband.pathrecord.rawtraffic",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_FlowLabel,
	{"FlowLabel", "infiniband.pathrecord.flowlabel",	 FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_HopLimit,
	{"HopLimit", "infiniband.pathrecord.hoplimit",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_TClass,
	{"TClass", "infiniband.pathrecord.tclass",			FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_Reversible,
	{"Reversible", "infiniband.pathrecord.reversible",	 FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_NumbPath,
	{"NumbPath", "infiniband.pathrecord.numbpath",		FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_P_Key,
	{"P_Key", "infiniband.pathrecord.p_key",			FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_SL,
	{"SL", "infiniband.pathrecord.sl",					FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_MTUSelector,
	{"MTUSelector", "infiniband.pathrecord.mtuselector",	 FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_MTU,
	{"MTU", "infiniband.pathrecord.mtu",					FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_RateSelector,
	{"RateSelector", "infiniband.pathrecord.rateselector",	 FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_Rate,
	{"Rate", "infiniband.pathrecord.rate",					FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_PacketLifeTimeSelector,
	{"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector",	 FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_PacketLifeTime,
	{"PacketLifeTime", "infiniband.pathrecord.packetlifetime",	 FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
	},
	{&hf_infiniband_PathRecord_Preference,
	{"Preference", "infiniband.pathrecord.preference",			FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* MCMemberRecord */
	{&hf_infiniband_MCMemberRecord_MGID,
	{"MGID", "infiniband.mcmemberrecord.mgid",					FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_PortGID,
	{"PortGID", "infiniband.mcmemberrecord.portgid",			FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_Q_Key,
	{"Q_Key", "infiniband.mcmemberrecord.q_key",				FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_MLID,
	{"MLID", "infiniband.mcmemberrecord.mlid",					FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_MTUSelector,
	{"MTUSelector", "infiniband.mcmemberrecord.mtuselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_MTU,
	{"MTU", "infiniband.mcmemberrecord.mtu",					FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_TClass,
	{"TClass", "infiniband.mcmemberrecord.tclass",				FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_P_Key,
	{"P_Key", "infiniband.mcmemberrecord.p_key",				FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_RateSelector,
	{"RateSelector", "infiniband.mcmemberrecord.rateselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_Rate,
	{"Rate", "infiniband.mcmemberrecord.rate",					FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,
	{"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_PacketLifeTime,
	{"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime",					FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_SL,
	{"SL", "infiniband.mcmemberrecord.sl",					FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_FlowLabel,
	{"FlowLabel", "infiniband.mcmemberrecord.flowlabel",	FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_HopLimit,
	{"HopLimit", "infiniband.mcmemberrecord.hoplimit",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_Scope,
	{"Scope", "infiniband.mcmemberrecord.scope",			FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_JoinState,
	{"JoinState", "infiniband.mcmemberrecord.joinstate",	FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
	},
	{&hf_infiniband_MCMemberRecord_ProxyJoin,
	{"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin",	FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
	},
	/* MultiPathRecord */
	{&hf_infiniband_MultiPathRecord_RawTraffic,
	{"RawTraffic", "infiniband.multipathrecord.rawtraffic",	FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_FlowLabel,
	{"FlowLabel", "infiniband.multipathrecord.flowlabel",	FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_HopLimit,
	{"HopLimit", "infiniband.multipathrecord.hoplimit",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_TClass,
	{"TClass", "infiniband.multipathrecord.tclass",			FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_Reversible,
	{"Reversible", "infiniband.multipathrecord.reversible",		FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_NumbPath,
	{"NumbPath", "infiniband.multipathrecord.numbpath",		FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_P_Key,
	{"P_Key", "infiniband.multipathrecord.p_key",		FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_SL,
	{"SL", "infiniband.multipathrecord.sl",			FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_MTUSelector,
	{"MTUSelector", "infiniband.multipathrecord.mtuselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_MTU,
	{"MTU", "infiniband.multipathrecord.mtu",			FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_RateSelector,
	{"RateSelector", "infiniband.multipathrecord.rateselector",	FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_Rate,
	{"Rate", "infiniband.multipathrecord.rate",			FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,
	{"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_PacketLifeTime,
	{"PacketLifeTime", "infiniband.multipathrecord.packetlifetime",			FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_IndependenceSelector,
	{"IndependenceSelector", "infiniband.multipathrecord.independenceselector",	FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_GIDScope,
	{"GIDScope", "infiniband.multipathrecord.gidscope",		FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_SGIDCount,
	{"SGIDCount", "infiniband.multipathrecord.sgidcount",	FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_DGIDCount,
	{"DGIDCount", "infiniband.multipathrecord.dgidcount",	FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_MultiPathRecord_SDGID,
	{"SDGID", "infiniband.multipathrecord.sdgid",			FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Notice */
	{&hf_infiniband_Notice_IsGeneric,
	{"IsGeneric", "infiniband.notice.isgeneric",	FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_Notice_Type,
	{"Type", "infiniband.notice.type",				FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
	},
	{&hf_infiniband_Notice_ProducerTypeVendorID,
	{"ProducerTypeVendorID", "infiniband.notice.producertypevendorid",	FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Notice_TrapNumberDeviceID,
	{"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid",		FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Notice_IssuerLID,
	{"IssuerLID", "infiniband.notice.issuerlid",		FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Notice_NoticeToggle,
	{"NoticeToggle", "infiniband.notice.noticetoggle",	FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_Notice_NoticeCount,
	{"NoticeCount", "infiniband.notice.noticecount",	FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
	},
	{&hf_infiniband_Notice_DataDetails,
	{"DataDetails", "infiniband.notice.datadetails",	FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Notice_IssuerGID,
	{"IssuerGID", "infiniband.notice.issuergid",		FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Notice_ClassTrapSpecificData,
	{"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata",		FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Traps 64,65,66,67 */
	{&hf_infiniband_Trap_GIDADDR,
	{"GIDADDR", "infiniband.trap.gidaddr",		FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Traps 68,69 */
	{&hf_infiniband_Trap_COMP_MASK,
	{"COMP_MASK", "infiniband.trap.comp_mask",		FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Trap_WAIT_FOR_REPATH,
	{"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath",		FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
	},
	{&hf_infiniband_Trap_PATH_REC,
	{"PATH_REC", "infiniband.trap.path_rec",		FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Trap 128 */
	{&hf_infiniband_Trap_LIDADDR,
	{"LIDADDR", "infiniband.trap.lidaddr",		FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Trap 129, 130, 131 */
	{&hf_infiniband_Trap_PORTNO,
	{"PORTNO", "infiniband.trap.portno",		FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	/* Trap 144 */
	{&hf_infiniband_Trap_OtherLocalChanges,
	{"OtherLocalChanges", "infiniband.trap.otherlocalchanges",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_CAPABILITYMASK,
	{"CAPABILITYMASK", "infiniband.trap.capabilitymask",		FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
	},
	{&hf_infiniband_Trap_LinkSpeecEnabledChange,
	{"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange",		FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
	},
	{&hf_infiniband_Trap_LinkWidthEnabledChange,
	{"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange",		FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
	},
	{&hf_infiniband_Trap_NodeDescriptionChange,
	{"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	/* Trap 145 */
	{&hf_infiniband_Trap_SYSTEMIMAGEGUID,
	{"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid",		FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	/* Trap 256 */
	{&hf_infiniband_Trap_DRSLID,
	{"DRSLID", "infiniband.trap.drslid",		FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_METHOD,
	{"METHOD", "infiniband.trap.method",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_ATTRIBUTEID,
	{"ATTRIBUTEID", "infiniband.trap.attributeid",		FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_ATTRIBUTEMODIFIER,
	{"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier",		FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_MKEY,
	{"MKEY", "infiniband.trap.mkey",		FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_DRNotice,
	{"DRNotice", "infiniband.trap.drnotice",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_DRPathTruncated,
	{"DRPathTruncated", "infiniband.trap.drpathtruncated",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_DRHopCount,
	{"DRHopCount", "infiniband.trap.drhopcount",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_DRNoticeReturnPath,
	{"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath",		FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	/* Trap 257, 258 */
	{&hf_infiniband_Trap_LIDADDR1,
	{"LIDADDR1", "infiniband.trap.lidaddr1",		FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_LIDADDR2,
	{"LIDADDR2", "infiniband.trap.lidaddr2",		FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_KEY,
	{"KEY", "infiniband.trap.key",		FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_SL,
	{"SL", "infiniband.trap.sl",		FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_QP1,
	{"QP1", "infiniband.trap.qp1",		FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_QP2,
	{"QP2", "infiniband.trap.qp2",		FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_GIDADDR1,
	{"GIDADDR1", "infiniband.trap.gidaddr1",		FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	{&hf_infiniband_Trap_GIDADDR2,
	{"GIDADDR2", "infiniband.trap.gidaddr2",		FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
	/* Trap 259 */
	{&hf_infiniband_Trap_DataValid,
	{"DataValid", "infiniband.trap.datavalid",		FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
		{&hf_infiniband_Trap_PKEY,
	{"PKEY", "infiniband.trap.pkey",		FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
	},
		{&hf_infiniband_Trap_SWLIDADDR,
	{"SWLIDADDR", "infiniband.trap.swlidaddr",		FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
	}
};

/* Array to hold expansion options between dissections */
static gint *ett[] = {
	&ett_infiniband,
	&ett_all_headers,
	&ett_lrh,
	&ett_grh,
	&ett_bth,
	&ett_rwh,
	&ett_rawdata,
	&ett_rdeth,
	&ett_deth,
	&ett_reth,
	&ett_atomiceth,
	&ett_aeth,
	&ett_atomicacketh,
	&ett_immdt,
	&ett_ieth,
	&ett_payload,
	&ett_vendor,
	&ett_subn_lid_routed,
	&ett_subn_directed_route,
	&ett_subnadmin,
	&ett_mad,
	&ett_rmpp,
	&ett_subm_attribute,
	&ett_suba_attribute,
	&ett_datadetails,
	&ett_noticestraps,
	&ett_nodedesc,
	&ett_nodeinfo,
	&ett_switchinfo,
	&ett_guidinfo,
	&ett_portinfo,
	&ett_portinfo_capmask,
	&ett_pkeytable,
	&ett_sltovlmapping,
	&ett_vlarbitrationtable,
	&ett_linearforwardingtable,
	&ett_randomforwardingtable,
	&ett_multicastforwardingtable,
	&ett_sminfo,
	&ett_vendordiag,
	&ett_ledinfo,
	&ett_linkspeedwidthpairs,
	&ett_informinfo,
	&ett_linkrecord,
	&ett_servicerecord,
	&ett_pathrecord,
	&ett_mcmemberrecord,
	&ett_tracerecord,
	&ett_multipathrecord,
	&ett_serviceassocrecord
};


#endif