2575 lines
106 KiB
C
2575 lines
106 KiB
C
/* packet-infiniband.h
|
|
* Routines for Infiniband/ERF Dissection
|
|
* Copyright 2008 Endace Technology Limited
|
|
*
|
|
* $Id$
|
|
*
|
|
* Wireshark - Network traffic analyzer
|
|
* By Gerald Combs <gerald@wireshark.org>
|
|
* Copyright 1998 Gerald Combs
|
|
*
|
|
* This program is free software; you can redistribute it and/or
|
|
* modify it under the terms of the GNU General Public License
|
|
* as published by the Free Software Foundation; either version 2
|
|
* of the License, or (at your option) any later version.
|
|
*
|
|
* This program is distributed in the hope that it will be useful,
|
|
* but WITHOUT ANY WARRANTY; without even the implied warranty of
|
|
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
|
* GNU General Public License for more details.
|
|
*
|
|
* You should have received a copy of the GNU General Public License
|
|
* along with this program; if not, write to the Free Software
|
|
* Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
|
|
*/
|
|
#ifndef __PACKET_INFINIBAND_H_
|
|
#define __PACKET_INFINIBAND_H_
|
|
|
|
#define PROTO_TAG_INFINIBAND "Infiniband"
|
|
|
|
#include <epan/etypes.h>
|
|
|
|
/* Wireshark ID */
|
|
static int proto_infiniband = -1;
|
|
|
|
/* Variables to hold expansion values between packets */
|
|
static gint ett_infiniband = -1;
|
|
static gint ett_all_headers = -1;
|
|
static gint ett_lrh = -1;
|
|
static gint ett_grh = -1;
|
|
static gint ett_bth = -1;
|
|
static gint ett_rwh = -1;
|
|
static gint ett_rawdata = -1;
|
|
static gint ett_rdeth = -1;
|
|
static gint ett_deth = -1;
|
|
static gint ett_reth = -1;
|
|
static gint ett_atomiceth = -1;
|
|
static gint ett_aeth = -1;
|
|
static gint ett_atomicacketh = -1;
|
|
static gint ett_immdt = -1;
|
|
static gint ett_ieth = -1;
|
|
static gint ett_payload = -1;
|
|
static gint ett_vendor = -1;
|
|
static gint ett_subn_lid_routed = -1;
|
|
static gint ett_subn_directed_route = -1;
|
|
static gint ett_subnadmin = -1;
|
|
static gint ett_mad = -1;
|
|
static gint ett_rmpp = -1;
|
|
static gint ett_subm_attribute = -1;
|
|
static gint ett_suba_attribute = -1;
|
|
static gint ett_datadetails = -1;
|
|
static gint ett_noticestraps = -1;
|
|
static gint ett_nodedesc = -1;
|
|
static gint ett_nodeinfo = -1;
|
|
static gint ett_switchinfo = -1;
|
|
static gint ett_guidinfo = -1;
|
|
static gint ett_portinfo = -1;
|
|
static gint ett_portinfo_capmask = -1;
|
|
static gint ett_pkeytable = -1;
|
|
static gint ett_sltovlmapping = -1;
|
|
static gint ett_vlarbitrationtable = -1;
|
|
static gint ett_linearforwardingtable = -1;
|
|
static gint ett_randomforwardingtable = -1;
|
|
static gint ett_multicastforwardingtable = -1;
|
|
static gint ett_sminfo = -1;
|
|
static gint ett_vendordiag = -1;
|
|
static gint ett_ledinfo = -1;
|
|
static gint ett_linkspeedwidthpairs = -1;
|
|
static gint ett_informinfo = -1;
|
|
static gint ett_linkrecord = -1;
|
|
static gint ett_servicerecord = -1;
|
|
static gint ett_pathrecord = -1;
|
|
static gint ett_mcmemberrecord = -1;
|
|
static gint ett_tracerecord = -1;
|
|
static gint ett_multipathrecord = -1;
|
|
static gint ett_serviceassocrecord = -1;
|
|
|
|
/* Global ref to highest level tree should we find other protocols encapsulated in IB */
|
|
static proto_tree *top_tree = NULL;
|
|
|
|
/* MAD_Data
|
|
* Structure to hold information from the common MAD header.
|
|
* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
|
|
typedef struct {
|
|
guint8 managementClass;
|
|
guint8 classVersion;
|
|
guint8 method;
|
|
guint8 status;
|
|
guint16 classSpecific;
|
|
guint64 transactionID;
|
|
guint16 attributeID;
|
|
guint32 attributeModifier;
|
|
char data[232];
|
|
} MAD_Data;
|
|
|
|
/* Dissector Declarations */
|
|
static dissector_handle_t ipv6_handle;
|
|
static dissector_handle_t data_handle;
|
|
static dissector_table_t ethertype_dissector_table;
|
|
|
|
static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree);
|
|
static gint32 find_next_header_sequence(guint32 OpCode);
|
|
static gboolean contains(guint32 value, guint32* arr, int length);
|
|
static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo);
|
|
|
|
/* Parsing Methods for specific IB headers. */
|
|
|
|
static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *);
|
|
static void parse_PAYLOAD(proto_tree *, packet_info *, tvbuff_t *, gint *, gint length, guint8 virtualLane);
|
|
static void parse_IETH(proto_tree *, tvbuff_t *, gint *);
|
|
static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
|
|
static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
|
|
|
|
static void parse_SUBN_LID_ROUTED(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
|
|
static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
|
|
static void parse_SUBNADMN(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
|
|
static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_BM(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
|
|
static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
|
|
|
|
static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
|
|
static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset);
|
|
static void label_SUBM_Method(proto_item*, MAD_Data*, packet_info*);
|
|
static void label_SUBM_Attribute(proto_item*, MAD_Data*, packet_info*);
|
|
static void label_SUBA_Method(proto_item*, MAD_Data*, packet_info*);
|
|
static void label_SUBA_Attribute(proto_item*, MAD_Data*, packet_info*);
|
|
|
|
/* Class Attribute Parsing Routines */
|
|
static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
|
|
static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
|
|
|
|
/* These methods parse individual attributes
|
|
* Naming convention FunctionHandle = "parse_" + [Attribute Name];
|
|
* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
|
|
* Subnet Management */
|
|
static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset);
|
|
|
|
/* Subnet Administration */
|
|
static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset);
|
|
|
|
/* Subnet Administration */
|
|
static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
|
|
|
|
/* SM Methods */
|
|
static const value_string SUBM_Methods[] = {
|
|
{ 0x01, "SubnGet("},
|
|
{ 0x02, "SubnSet("},
|
|
{ 0x81, "SubnGetResp("},
|
|
{ 0x05, "SubnTrap("},
|
|
{ 0x07, "SubnTrapResp("},
|
|
{ 0, NULL}
|
|
};
|
|
/* SM Attributes */
|
|
static const value_string SUBM_Attributes[] = {
|
|
{ 0x0001, "Attribute (ClassPortInfo)"},
|
|
{ 0x0002, "Attribute (Notice)"},
|
|
{ 0x0003, "Attribute (InformInfo)"},
|
|
{ 0x0010, "Attribute (NodeDescription)"},
|
|
{ 0x0011, "Attribute (NodeInfo)"},
|
|
{ 0x0012, "Attribute (SwitchInfo)"},
|
|
{ 0x0014, "Attribute (GUIDInfo)"},
|
|
{ 0x0015, "Attribute (PortInfo)"},
|
|
{ 0x0016, "Attribute (P_KeyTable)"},
|
|
{ 0x0017, "Attribute (SLtoVLMapptingTable)"},
|
|
{ 0x0018, "Attribute (VLArbitrationTable)"},
|
|
{ 0x0019, "Attribute (LinearForwardingTable)"},
|
|
{ 0x001A, "Attribute (RandomForwardingTable)"},
|
|
{ 0x001B, "Attribute (MulticastForwardingTable)"},
|
|
{ 0x001C, "Attribute (LinkSpeedWidthPairsTable)"},
|
|
{ 0x0020, "Attribute (SMInfo)"},
|
|
{ 0x0030, "Attribute (VendorDiag)"},
|
|
{ 0x0031, "Attribute (LedInfo)"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
/* SA Methods */
|
|
static const value_string SUBA_Methods[] = {
|
|
{ 0x01, "SubnAdmGet("},
|
|
{ 0x81, "SubnAdmGetResp("},
|
|
{ 0x02, "SubnAdmSet("},
|
|
{ 0x06, "SubnAdmReport("},
|
|
{ 0x86, "SubnAdmReportResp("},
|
|
{ 0x12, "SubnAdmGetTable("},
|
|
{ 0x92, "SubnAdmGetTableResp("},
|
|
{ 0x13, "SubnAdmGetTraceTable("},
|
|
{ 0x14, "SubnAdmGetMulti("},
|
|
{ 0x94, "SubnAdmGetMultiResp("},
|
|
{ 0x15, "SubnAdmDelete("},
|
|
{ 0x95, "SubnAdmDeleteResp("},
|
|
{ 0, NULL}
|
|
};
|
|
/* SA Attributes */
|
|
static const value_string SUBA_Attributes[] = {
|
|
{ 0x0001, "Attribute (ClassPortInfo)"},
|
|
{ 0x0002, "Attribute (Notice)"},
|
|
{ 0x0003, "Attribute (InformInfo)"},
|
|
{ 0x0011, "Attribute (NodeRecord)"},
|
|
{ 0x0012, "Attribute (PortInfoRecord)"},
|
|
{ 0x0013, "Attribute (SLtoVLMappingTableRecord)"},
|
|
{ 0x0014, "Attribute (SwitchInfoRecord)"},
|
|
{ 0x0015, "Attribute (LinearForwardingTableRecord)"},
|
|
{ 0x0016, "Attribute (RandomForwardingTableRecord)"},
|
|
{ 0x0017, "Attribute (MulticastForwardingTableRecord)"},
|
|
{ 0x0018, "Attribute (SMInfoRecord)"},
|
|
{ 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"},
|
|
{ 0x00F3, "Attribute (InformInfoRecord)"},
|
|
{ 0x0020, "Attribute (LinkRecord)"},
|
|
{ 0x0030, "Attribute (GuidInfoRecord)"},
|
|
{ 0x0031, "Attribute (ServiceRecord)"},
|
|
{ 0x0033, "Attribute (P_KeyTableRecord)"},
|
|
{ 0x0035, "Attribute (PathRecord)"},
|
|
{ 0x0036, "Attribute (VLArbitrationTableRecord)"},
|
|
{ 0x0038, "Attribute (MCMembersRecord)"},
|
|
{ 0x0039, "Attribute (TraceRecord)"},
|
|
{ 0x003A, "Attribute (MultiPathRecord)"},
|
|
{ 0x003B, "Attribute (ServiceAssociationRecord)"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
|
|
/* RMPP Types */
|
|
#define RMPP_ILLEGAL 0
|
|
#define RMPP_DATA 1
|
|
#define RMPP_ACK 2
|
|
#define RMPP_STOP 3
|
|
#define RMPP_ABORT 4
|
|
|
|
static const value_string RMPP_Packet_Types[] = {
|
|
{ RMPP_ILLEGAL, " Illegal RMPP Type (0)! " },
|
|
{ RMPP_DATA, "RMPP (DATA)" },
|
|
{ RMPP_ACK, "RMPP (ACK)" },
|
|
{ RMPP_STOP, "RMPP (STOP)" },
|
|
{ RMPP_ABORT, "RMPP (ABORT)" },
|
|
{ 0, NULL}
|
|
};
|
|
|
|
static const value_string RMPP_Flags[] = {
|
|
{ 3, " (Transmission Sequence - First Packet)"},
|
|
{ 5, " (Transmission Sequence - Last Packet)"},
|
|
{ 1, " (Transmission Sequence) " },
|
|
{ 0, NULL}
|
|
};
|
|
|
|
static const value_string RMPP_Status[]= {
|
|
{ 0, " (Normal)"},
|
|
{ 1, " (Resources Exhausted)"},
|
|
{ 118, " (Total Time Too Long)"},
|
|
{ 119, " (Inconsistent Last and PayloadLength)"},
|
|
{ 120, " (Inconsistent First and Segment Number)"},
|
|
{ 121, " (Bad RMPPType)"},
|
|
{ 122, " (NewWindowLast Too Small)"},
|
|
{ 123, " (SegmentNumber Too Big)"},
|
|
{ 124, " (Illegal Status)"},
|
|
{ 125, " (Unsupported Version)"},
|
|
{ 126, " (Too Many Retries)"},
|
|
{ 127, " (Unspecified - Unknown Error Code on ABORT)"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
static const value_string DiagCode[]= {
|
|
{0x0000, "Function Ready"},
|
|
{0x0001, "Performing Self Test"},
|
|
{0x0002, "Initializing"},
|
|
{0x0003, "Soft Error - Function has non-fatal error"},
|
|
{0x0004, "Hard Error - Function has fatal error"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkWidthEnabled[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "1x"},
|
|
{0x0002, "4x"},
|
|
{0x0003, "1x or 4x"},
|
|
{0x0004, "8x"},
|
|
{0x0005, "1x or 8x"},
|
|
{0x0006, "4x or 8x"},
|
|
{0x0007, "1x or 4x or 8x"},
|
|
{0x0008, "12x"},
|
|
{0x0009, "1x or 12x"},
|
|
{0x000A, "4x or 12x"},
|
|
{0x000B, "1x or 4x or 12x"},
|
|
{0x000C, "8x or 12x"},
|
|
{0x000D, "1x or 8x or 12x"},
|
|
{0x000E, "4x or 8x or 12x"},
|
|
{0x000E, "1x or 4x or 8x or 12x"},
|
|
{0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
static const value_string LinkWidthSupported[]= {
|
|
{0x0001, "1x"},
|
|
{0x0003, "1x or 4x"},
|
|
{0x0007, "1x or 4x or 8x"},
|
|
{0x000B, "1x or 4x or 12x"},
|
|
{0x000F, "1x or 4x or 8x or 12x"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkWidthActive[]= {
|
|
{0x0001, "1x"},
|
|
{0x0002, "4x"},
|
|
{0x0004, "8x"},
|
|
{0x0008, "12x"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkSpeedSupported[]= {
|
|
{0x0001, "2.5 Gbps"},
|
|
{0x0003, "2.5 or 5.0 Gbps"},
|
|
{0x0005, "2.5 or 10.0 Gbps"},
|
|
{0x0007, "2.5 or 5.0 or 10.0 Gbps"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string PortState[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "Down (includes failed links)"},
|
|
{0x0002, "Initialized"},
|
|
{0x0003, "Armed"},
|
|
{0x0004, "Active"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string PortPhysicalState[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "Sleep"},
|
|
{0x0002, "Polling"},
|
|
{0x0003, "Disabled"},
|
|
{0x0004, "PortConfigurationTraining"},
|
|
{0x0005, "LinkUp"},
|
|
{0x0006, "LinkErrorRecovery"},
|
|
{0x0007, "Phy Test"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkDownDefaultState[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "Sleep"},
|
|
{0x0002, "Polling"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkSpeedActive[]= {
|
|
{0x0001, "2.5 Gbps"},
|
|
{0x0002, "5.0 Gbps"},
|
|
{0x0004, "10.0 Gbps"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string LinkSpeedEnabled[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "2.5 Gbps"},
|
|
{0x0003, "2.5 or 5.0 Gbps"},
|
|
{0x0005, "2.5 or 10.0 Gbps"},
|
|
{0x0007, "2.5 or 5.0 or 10.0 Gbps"},
|
|
{0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string NeighborMTU[]= {
|
|
{0x0001, "256"},
|
|
{0x0002, "512"},
|
|
{0x0003, "1024"},
|
|
{0x0004, "2048"},
|
|
{0x0005, "4096"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string VLCap[]= {
|
|
{0x0001, "VL0"},
|
|
{0x0002, "VL0, VL1"},
|
|
{0x0003, "VL0 - VL3"},
|
|
{0x0004, "VL0 - VL7"},
|
|
{0x0005, "VL0 - VL14"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string MTUCap[]= {
|
|
{0x0001, "256"},
|
|
{0x0002, "512"},
|
|
{0x0003, "1024"},
|
|
{0x0004, "2048"},
|
|
{0x0005, "4096"},
|
|
{ 0, NULL}
|
|
};
|
|
static const value_string OperationalVLs[]= {
|
|
{0x0000, "No State Change"},
|
|
{0x0001, "VL0"},
|
|
{0x0002, "VL0, VL1"},
|
|
{0x0003, "VL0 - VL3"},
|
|
{0x0004, "VL0 - VL7"},
|
|
{0x0005, "VL0 - VL14"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
/* Local Route Header (LRH) */
|
|
static int hf_infiniband_LRH = -1;
|
|
static int hf_infiniband_virtual_lane = -1;
|
|
static int hf_infiniband_link_version = -1;
|
|
static int hf_infiniband_service_level = -1;
|
|
static int hf_infiniband_reserved2 = -1;
|
|
static int hf_infiniband_link_next_header = -1;
|
|
static int hf_infiniband_destination_local_id = -1;
|
|
static int hf_infiniband_reserved5 = -1;
|
|
static int hf_infiniband_packet_length = -1;
|
|
static int hf_infiniband_source_local_id = -1;
|
|
/* Global Route Header (GRH) */
|
|
static int hf_infiniband_GRH = -1;
|
|
static int hf_infiniband_ip_version = -1;
|
|
static int hf_infiniband_traffic_class = -1;
|
|
static int hf_infiniband_flow_label = -1;
|
|
static int hf_infiniband_payload_length = -1;
|
|
static int hf_infiniband_next_header = -1;
|
|
static int hf_infiniband_hop_limit = -1;
|
|
static int hf_infiniband_source_gid = -1;
|
|
static int hf_infiniband_destination_gid = -1;
|
|
/* Base Transport Header (BTH) */
|
|
static int hf_infiniband_BTH = -1;
|
|
static int hf_infiniband_opcode = -1;
|
|
static int hf_infiniband_solicited_event = -1;
|
|
static int hf_infiniband_migreq = -1;
|
|
static int hf_infiniband_pad_count = -1;
|
|
static int hf_infiniband_transport_header_version = -1;
|
|
static int hf_infiniband_partition_key = -1;
|
|
static int hf_infiniband_reserved8 = -1;
|
|
static int hf_infiniband_destination_qp = -1;
|
|
static int hf_infiniband_acknowledge_request = -1;
|
|
static int hf_infiniband_reserved7 = -1;
|
|
static int hf_infiniband_packet_sequence_number = -1;
|
|
/* Raw Header (RWH) */
|
|
static int hf_infiniband_RWH = -1;
|
|
static int hf_infiniband_reserved16_RWH = -1;
|
|
static int hf_infiniband_etype = -1;
|
|
/* Reliable Datagram Extended Transport Header (RDETH) */
|
|
static int hf_infiniband_RDETH = -1;
|
|
static int hf_infiniband_reserved8_RDETH = -1;
|
|
static int hf_infiniband_ee_context = -1;
|
|
/* Datagram Extended Transport Header (DETH) */
|
|
static int hf_infiniband_DETH = -1;
|
|
static int hf_infiniband_queue_key = -1;
|
|
static int hf_infiniband_reserved8_DETH = -1;
|
|
static int hf_infiniband_source_qp = -1;
|
|
/* RDMA Extended Transport Header (RETH) */
|
|
static int hf_infiniband_RETH = -1;
|
|
static int hf_infiniband_virtual_address = -1;
|
|
static int hf_infiniband_remote_key = -1;
|
|
static int hf_infiniband_dma_length = -1;
|
|
/* Atomic Extended Transport Header (AtomicETH) */
|
|
static int hf_infiniband_AtomicETH = -1;
|
|
static int hf_infiniband_virtual_address_AtomicETH = -1;
|
|
static int hf_infiniband_remote_key_AtomicETH = -1;
|
|
static int hf_infiniband_swap_or_add_data = -1;
|
|
static int hf_infiniband_compare_data = -1;
|
|
/* ACK Extended Transport Header (AETH) */
|
|
static int hf_infiniband_AETH = -1;
|
|
static int hf_infiniband_syndrome = -1;
|
|
static int hf_infiniband_message_sequence_number = -1;
|
|
/* Atomic ACK Extended Transport Header (AtomicAckETH) */
|
|
static int hf_infiniband_AtomicAckETH = -1;
|
|
static int hf_infiniband_original_remote_data = -1;
|
|
/* Immediate Extended Transport Header (ImmDt) */
|
|
static int hf_infiniband_IMMDT = -1;
|
|
/* Invalidate Extended Transport Header (IETH) */
|
|
static int hf_infiniband_IETH = -1;
|
|
/* Payload */
|
|
static int hf_infiniband_payload = -1;
|
|
static int hf_infiniband_invariant_crc = -1;
|
|
static int hf_infiniband_variant_crc = -1;
|
|
/* Unknown or Vendor Specific */
|
|
static int hf_infiniband_raw_data = -1;
|
|
static int hf_infiniband_vendor = -1;
|
|
/* MAD Base Header */
|
|
static int hf_infiniband_MAD = -1;
|
|
static int hf_infiniband_base_version = -1;
|
|
static int hf_infiniband_mgmt_class = -1;
|
|
static int hf_infiniband_class_version = -1;
|
|
static int hf_infiniband_reserved1 = -1;
|
|
static int hf_infiniband_method = -1;
|
|
static int hf_infiniband_status = -1;
|
|
static int hf_infiniband_class_specific = -1;
|
|
static int hf_infiniband_transaction_id = -1;
|
|
static int hf_infiniband_attribute_id = -1;
|
|
static int hf_infiniband_reserved16 = -1;
|
|
static int hf_infiniband_attribute_modifier = -1;
|
|
static int hf_infiniband_data = -1;
|
|
/* RMPP Header */
|
|
static int hf_infiniband_RMPP = -1;
|
|
static int hf_infiniband_rmpp_version = -1;
|
|
static int hf_infiniband_rmpp_type = -1;
|
|
static int hf_infiniband_r_resp_time = -1;
|
|
static int hf_infiniband_rmpp_flags = -1;
|
|
static int hf_infiniband_rmpp_status = -1;
|
|
static int hf_infiniband_rmpp_data1 = -1;
|
|
static int hf_infiniband_rmpp_data2 = -1;
|
|
/* RMPP Data */
|
|
static int hf_infiniband_RMPP_DATA = -1;
|
|
static int hf_infiniband_segment_number = -1;
|
|
static int hf_infiniband_payload_length32 = -1;
|
|
static int hf_infiniband_transferred_data = -1;
|
|
/* RMPP ACK */
|
|
static int hf_infiniband_new_window_last = -1;
|
|
static int hf_infiniband_reserved220 = -1;
|
|
/* RMPP ABORT and STOP */
|
|
static int hf_infiniband_reserved32 = -1;
|
|
static int hf_infiniband_optional_extended_error_data = -1;
|
|
/* SMP Data LID Routed */
|
|
static int hf_infiniband_SMP_LID = -1;
|
|
static int hf_infiniband_m_key = -1;
|
|
static int hf_infiniband_smp_data = -1;
|
|
static int hf_infiniband_reserved1024 = -1;
|
|
static int hf_infiniband_reserved256 = -1;
|
|
/* SMP Data Directed Route */
|
|
static int hf_infiniband_SMP_DIRECTED = -1;
|
|
static int hf_infiniband_smp_status = -1;
|
|
static int hf_infiniband_hop_pointer = -1;
|
|
static int hf_infiniband_hop_count = -1;
|
|
static int hf_infiniband_dr_slid = -1;
|
|
static int hf_infiniband_dr_dlid = -1;
|
|
static int hf_infiniband_reserved28 = -1;
|
|
static int hf_infiniband_d = -1;
|
|
static int hf_infiniband_initial_path = -1;
|
|
static int hf_infiniband_return_path = -1;
|
|
/* SA MAD Header */
|
|
static int hf_infiniband_SA = -1;
|
|
static int hf_infiniband_sm_key = -1;
|
|
static int hf_infiniband_attribute_offset = -1;
|
|
static int hf_infiniband_component_mask = -1;
|
|
static int hf_infiniband_subnet_admin_data = -1;
|
|
|
|
/* Attributes
|
|
* Additional Structures for individuala attribute decoding.
|
|
* Since they are not headers the naming convention is slightly modified
|
|
* Convention: hf_infiniband_[attribute name]_[field]
|
|
* This was not entirely necessary but I felt the previous convention
|
|
* did not provide adequate readability for the granularity of attribute/attribute fields. */
|
|
|
|
/* NodeDescription */
|
|
static int hf_infiniband_NodeDescription_NodeString = -1;
|
|
/* NodeInfo */
|
|
static int hf_infiniband_NodeInfo_BaseVersion = -1;
|
|
static int hf_infiniband_NodeInfo_ClassVersion = -1;
|
|
static int hf_infiniband_NodeInfo_NodeType = -1;
|
|
static int hf_infiniband_NodeInfo_NumPorts = -1;
|
|
static int hf_infiniband_NodeInfo_SystemImageGUID = -1;
|
|
static int hf_infiniband_NodeInfo_NodeGUID = -1;
|
|
static int hf_infiniband_NodeInfo_PortGUID = -1;
|
|
static int hf_infiniband_NodeInfo_PartitionCap = -1;
|
|
static int hf_infiniband_NodeInfo_DeviceID = -1;
|
|
static int hf_infiniband_NodeInfo_Revision = -1;
|
|
static int hf_infiniband_NodeInfo_LocalPortNum = -1;
|
|
static int hf_infiniband_NodeInfo_VendorID = -1;
|
|
/* SwitchInfo */
|
|
static int hf_infiniband_SwitchInfo_LinearFDBCap = -1;
|
|
static int hf_infiniband_SwitchInfo_RandomFDBCap = -1;
|
|
static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1;
|
|
static int hf_infiniband_SwitchInfo_LinearFDBTop = -1;
|
|
static int hf_infiniband_SwitchInfo_DefaultPort = -1;
|
|
static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1;
|
|
static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1;
|
|
static int hf_infiniband_SwitchInfo_LifeTimeValue = -1;
|
|
static int hf_infiniband_SwitchInfo_PortStateChange = -1;
|
|
static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1;
|
|
static int hf_infiniband_SwitchInfo_LIDsPerPort = -1;
|
|
static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1;
|
|
static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1;
|
|
static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1;
|
|
static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1;
|
|
static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1;
|
|
static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1;
|
|
/* GUIDInfo */
|
|
static int hf_infiniband_GUIDInfo_GUIDBlock = -1;
|
|
static int hf_infiniband_GUIDInfo_GUID = -1;
|
|
/* PortInfo */
|
|
static int hf_infiniband_PortInfo_GidPrefix = -1;
|
|
static int hf_infiniband_PortInfo_LID = -1;
|
|
static int hf_infiniband_PortInfo_MasterSMLID = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask = -1;
|
|
|
|
/* Capability Mask Flags */
|
|
static int hf_infiniband_PortInfo_CapabilityMask_SM;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1;
|
|
static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1;
|
|
/* End Capability Mask Flags */
|
|
|
|
|
|
static int hf_infiniband_PortInfo_DiagCode = -1;
|
|
static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1;
|
|
static int hf_infiniband_PortInfo_LocalPortNum = -1;
|
|
static int hf_infiniband_PortInfo_LinkWidthEnabled = -1;
|
|
static int hf_infiniband_PortInfo_LinkWidthSupported = -1;
|
|
static int hf_infiniband_PortInfo_LinkWidthActive = -1;
|
|
static int hf_infiniband_PortInfo_LinkSpeedSupported = -1;
|
|
static int hf_infiniband_PortInfo_PortState = -1;
|
|
static int hf_infiniband_PortInfo_PortPhysicalState = -1;
|
|
static int hf_infiniband_PortInfo_LinkDownDefaultState = -1;
|
|
static int hf_infiniband_PortInfo_M_KeyProtectBits = -1;
|
|
static int hf_infiniband_PortInfo_LMC = -1;
|
|
static int hf_infiniband_PortInfo_LinkSpeedActive = -1;
|
|
static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1;
|
|
static int hf_infiniband_PortInfo_NeighborMTU = -1;
|
|
static int hf_infiniband_PortInfo_MasterSMSL = -1;
|
|
static int hf_infiniband_PortInfo_VLCap = -1;
|
|
static int hf_infiniband_PortInfo_M_Key = -1;
|
|
static int hf_infiniband_PortInfo_InitType = -1;
|
|
static int hf_infiniband_PortInfo_VLHighLimit = -1;
|
|
static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1;
|
|
static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1;
|
|
static int hf_infiniband_PortInfo_InitTypeReply = -1;
|
|
static int hf_infiniband_PortInfo_MTUCap = -1;
|
|
static int hf_infiniband_PortInfo_VLStallCount = -1;
|
|
static int hf_infiniband_PortInfo_HOQLife = -1;
|
|
static int hf_infiniband_PortInfo_OperationalVLs = -1;
|
|
static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1;
|
|
static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1;
|
|
static int hf_infiniband_PortInfo_FilterRawInbound = -1;
|
|
static int hf_infiniband_PortInfo_FilterRawOutbound = -1;
|
|
static int hf_infiniband_PortInfo_M_KeyViolations = -1;
|
|
static int hf_infiniband_PortInfo_P_KeyViolations = -1;
|
|
static int hf_infiniband_PortInfo_Q_KeyViolations = -1;
|
|
static int hf_infiniband_PortInfo_GUIDCap = -1;
|
|
static int hf_infiniband_PortInfo_ClientReregister = -1;
|
|
static int hf_infiniband_PortInfo_SubnetTimeOut = -1;
|
|
static int hf_infiniband_PortInfo_RespTimeValue = -1;
|
|
static int hf_infiniband_PortInfo_LocalPhyErrors = -1;
|
|
static int hf_infiniband_PortInfo_OverrunErrors = -1;
|
|
static int hf_infiniband_PortInfo_MaxCreditHint = -1;
|
|
static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1;
|
|
|
|
/* P_KeyTable */
|
|
static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1;
|
|
static int hf_infiniband_P_KeyTable_MembershipType = -1;
|
|
static int hf_infiniband_P_KeyTable_P_KeyBase = -1;
|
|
|
|
/* SLtoVLMappingTable */
|
|
static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1;
|
|
static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1;
|
|
|
|
/* VLArbitrationTable */
|
|
static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1;
|
|
static int hf_infiniband_VLArbitrationTable_VL = -1;
|
|
static int hf_infiniband_VLArbitrationTable_Weight = -1;
|
|
|
|
/* LinearForwardingTable */
|
|
static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1;
|
|
static int hf_infiniband_LinearForwardingTable_Port = -1;
|
|
|
|
/* RandomForwardingTable */
|
|
static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1;
|
|
static int hf_infiniband_RandomForwardingTable_LID = -1;
|
|
static int hf_infiniband_RandomForwardingTable_Valid = -1;
|
|
static int hf_infiniband_RandomForwardingTable_LMC = -1;
|
|
static int hf_infiniband_RandomForwardingTable_Port = -1;
|
|
|
|
/* MulticastForwardingTable */
|
|
static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1;
|
|
static int hf_infiniband_MulticastForwardingTable_PortMask = -1;
|
|
|
|
/* SMInfo */
|
|
static int hf_infiniband_SMInfo_GUID = -1;
|
|
static int hf_infiniband_SMInfo_SM_Key = -1;
|
|
static int hf_infiniband_SMInfo_ActCount = -1;
|
|
static int hf_infiniband_SMInfo_Priority = -1;
|
|
static int hf_infiniband_SMInfo_SMState = -1;
|
|
|
|
/* VendorDiag */
|
|
static int hf_infiniband_VendorDiag_NextIndex = -1;
|
|
static int hf_infiniband_VendorDiag_DiagData = -1;
|
|
|
|
/* LedInfo */
|
|
static int hf_infiniband_LedInfo_LedMask = -1;
|
|
|
|
/* LinkSpeedWidthPairsTable */
|
|
static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1;
|
|
static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1;
|
|
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1;
|
|
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1;
|
|
static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1;
|
|
|
|
/* Attributes for Subnet Administration.
|
|
* Mostly we have "Records" here which are just structures of SM attributes.
|
|
* There are some unique attributes though that we will want to have a structure for. */
|
|
|
|
/* NodeRecord */
|
|
/* PortInfoRecord */
|
|
/* SLtoVLMappingTableRecord */
|
|
/* SwitchInfoRecord */
|
|
/* LinearForwardingTableRecord */
|
|
/* RandomForwardingTableRecord */
|
|
/* MulticastForwardingTableRecord */
|
|
/* VLArbitrationTableRecord */
|
|
|
|
static int hf_infiniband_SA_LID = -1;
|
|
static int hf_infiniband_SA_EndportLID = -1;
|
|
static int hf_infiniband_SA_PortNum = -1;
|
|
static int hf_infiniband_SA_InputPortNum = -1;
|
|
static int hf_infiniband_SA_OutputPortNum = -1;
|
|
static int hf_infiniband_SA_BlockNum_EightBit = -1;
|
|
static int hf_infiniband_SA_BlockNum_NineBit = -1;
|
|
static int hf_infiniband_SA_BlockNum_SixteenBit = -1;
|
|
static int hf_infiniband_SA_Position = -1;
|
|
static int hf_infiniband_SA_Index = -1;
|
|
|
|
/* InformInfoRecord */
|
|
static int hf_infiniband_InformInfoRecord_SubscriberGID = -1;
|
|
static int hf_infiniband_InformInfoRecord_Enum = -1;
|
|
|
|
/* InformInfo */
|
|
static int hf_infiniband_InformInfo_GID = -1;
|
|
static int hf_infiniband_InformInfo_LIDRangeBegin = -1;
|
|
static int hf_infiniband_InformInfo_LIDRangeEnd = -1;
|
|
static int hf_infiniband_InformInfo_IsGeneric = -1;
|
|
static int hf_infiniband_InformInfo_Subscribe = -1;
|
|
static int hf_infiniband_InformInfo_Type = -1;
|
|
static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1;
|
|
static int hf_infiniband_InformInfo_QPN = -1;
|
|
static int hf_infiniband_InformInfo_RespTimeValue = -1;
|
|
static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1;
|
|
|
|
/* LinkRecord */
|
|
static int hf_infiniband_LinkRecord_FromLID = -1;
|
|
static int hf_infiniband_LinkRecord_FromPort = -1;
|
|
static int hf_infiniband_LinkRecord_ToPort = -1;
|
|
static int hf_infiniband_LinkRecord_ToLID = -1;
|
|
|
|
/* ServiceRecord */
|
|
static int hf_infiniband_ServiceRecord_ServiceID = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceGID = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceP_Key = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceLease = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceKey = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceName = -1;
|
|
static int hf_infiniband_ServiceRecord_ServiceData = -1;
|
|
|
|
/* ServiceAssociationRecord */
|
|
static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1;
|
|
static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1;
|
|
|
|
/* PathRecord */
|
|
static int hf_infiniband_PathRecord_DGID = -1;
|
|
static int hf_infiniband_PathRecord_SGID = -1;
|
|
static int hf_infiniband_PathRecord_DLID = -1;
|
|
static int hf_infiniband_PathRecord_SLID = -1;
|
|
static int hf_infiniband_PathRecord_RawTraffic = -1;
|
|
static int hf_infiniband_PathRecord_FlowLabel = -1;
|
|
static int hf_infiniband_PathRecord_HopLimit = -1;
|
|
static int hf_infiniband_PathRecord_TClass = -1;
|
|
static int hf_infiniband_PathRecord_Reversible = -1;
|
|
static int hf_infiniband_PathRecord_NumbPath = -1;
|
|
static int hf_infiniband_PathRecord_P_Key = -1;
|
|
static int hf_infiniband_PathRecord_SL = -1;
|
|
static int hf_infiniband_PathRecord_MTUSelector = -1;
|
|
static int hf_infiniband_PathRecord_MTU = -1;
|
|
static int hf_infiniband_PathRecord_RateSelector = -1;
|
|
static int hf_infiniband_PathRecord_Rate = -1;
|
|
static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1;
|
|
static int hf_infiniband_PathRecord_PacketLifeTime = -1;
|
|
static int hf_infiniband_PathRecord_Preference = -1;
|
|
|
|
/* MCMemberRecord */
|
|
static int hf_infiniband_MCMemberRecord_MGID = -1;
|
|
static int hf_infiniband_MCMemberRecord_PortGID = -1;
|
|
static int hf_infiniband_MCMemberRecord_Q_Key = -1;
|
|
static int hf_infiniband_MCMemberRecord_MLID = -1;
|
|
static int hf_infiniband_MCMemberRecord_MTUSelector = -1;
|
|
static int hf_infiniband_MCMemberRecord_MTU = -1;
|
|
static int hf_infiniband_MCMemberRecord_TClass = -1;
|
|
static int hf_infiniband_MCMemberRecord_P_Key = -1;
|
|
static int hf_infiniband_MCMemberRecord_RateSelector = -1;
|
|
static int hf_infiniband_MCMemberRecord_Rate = -1;
|
|
static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1;
|
|
static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1;
|
|
static int hf_infiniband_MCMemberRecord_SL = -1;
|
|
static int hf_infiniband_MCMemberRecord_FlowLabel = -1;
|
|
static int hf_infiniband_MCMemberRecord_HopLimit = -1;
|
|
static int hf_infiniband_MCMemberRecord_Scope = -1;
|
|
static int hf_infiniband_MCMemberRecord_JoinState = -1;
|
|
static int hf_infiniband_MCMemberRecord_ProxyJoin = -1;
|
|
|
|
/* TraceRecord */
|
|
static int hf_infiniband_TraceRecord_GIDPrefix = -1;
|
|
static int hf_infiniband_TraceRecord_IDGeneration = -1;
|
|
static int hf_infiniband_TraceRecord_NodeType = -1;
|
|
static int hf_infiniband_TraceRecord_NodeID = -1;
|
|
static int hf_infiniband_TraceRecord_ChassisID = -1;
|
|
static int hf_infiniband_TraceRecord_EntryPortID = -1;
|
|
static int hf_infiniband_TraceRecord_ExitPortID = -1;
|
|
static int hf_infiniband_TraceRecord_EntryPort = -1;
|
|
static int hf_infiniband_TraceRecord_ExitPort = -1;
|
|
|
|
/* MultiPathRecord */
|
|
static int hf_infiniband_MultiPathRecord_RawTraffic = -1;
|
|
static int hf_infiniband_MultiPathRecord_FlowLabel = -1;
|
|
static int hf_infiniband_MultiPathRecord_HopLimit = -1;
|
|
static int hf_infiniband_MultiPathRecord_TClass = -1;
|
|
static int hf_infiniband_MultiPathRecord_Reversible = -1;
|
|
static int hf_infiniband_MultiPathRecord_NumbPath = -1;
|
|
static int hf_infiniband_MultiPathRecord_P_Key = -1;
|
|
static int hf_infiniband_MultiPathRecord_SL = -1;
|
|
static int hf_infiniband_MultiPathRecord_MTUSelector = -1;
|
|
static int hf_infiniband_MultiPathRecord_MTU = -1;
|
|
static int hf_infiniband_MultiPathRecord_RateSelector = -1;
|
|
static int hf_infiniband_MultiPathRecord_Rate = -1;
|
|
static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1;
|
|
static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1;
|
|
static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1;
|
|
static int hf_infiniband_MultiPathRecord_GIDScope = -1;
|
|
static int hf_infiniband_MultiPathRecord_SGIDCount = -1;
|
|
static int hf_infiniband_MultiPathRecord_DGIDCount = -1;
|
|
static int hf_infiniband_MultiPathRecord_SDGID = -1;
|
|
|
|
/* Notice */
|
|
static int hf_infiniband_Notice_IsGeneric = -1;
|
|
static int hf_infiniband_Notice_Type = -1;
|
|
static int hf_infiniband_Notice_ProducerTypeVendorID = -1;
|
|
static int hf_infiniband_Notice_TrapNumberDeviceID = -1;
|
|
static int hf_infiniband_Notice_IssuerLID = -1;
|
|
static int hf_infiniband_Notice_NoticeToggle = -1;
|
|
static int hf_infiniband_Notice_NoticeCount = -1;
|
|
static int hf_infiniband_Notice_DataDetails = -1;
|
|
static int hf_infiniband_Notice_IssuerGID = -1;
|
|
static int hf_infiniband_Notice_ClassTrapSpecificData = -1;
|
|
|
|
/* Notice DataDetails and ClassTrapSpecific Data for certain traps
|
|
* Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
|
|
* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */
|
|
|
|
/* Parse DataDetails for a given Trap */
|
|
static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber);
|
|
|
|
/* Traps 64,65,66,67 */
|
|
static int hf_infiniband_Trap_GIDADDR = -1;
|
|
|
|
/* Traps 68,69 */
|
|
/* DataDetails */
|
|
static int hf_infiniband_Trap_COMP_MASK = -1;
|
|
static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1;
|
|
/* ClassTrapSpecificData */
|
|
static int hf_infiniband_Trap_PATH_REC = -1;
|
|
|
|
/* Trap 128 */
|
|
static int hf_infiniband_Trap_LIDADDR = -1;
|
|
|
|
/* Trap 129, 130, 131 */
|
|
static int hf_infiniband_Trap_PORTNO = -1;
|
|
|
|
/* Trap 144 */
|
|
static int hf_infiniband_Trap_OtherLocalChanges = -1;
|
|
static int hf_infiniband_Trap_CAPABILITYMASK = -1;
|
|
static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1;
|
|
static int hf_infiniband_Trap_LinkWidthEnabledChange = -1;
|
|
static int hf_infiniband_Trap_NodeDescriptionChange = -1;
|
|
|
|
/* Trap 145 */
|
|
static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1;
|
|
|
|
/* Trap 256 */
|
|
static int hf_infiniband_Trap_DRSLID = -1;
|
|
static int hf_infiniband_Trap_METHOD = -1;
|
|
static int hf_infiniband_Trap_ATTRIBUTEID = -1;
|
|
static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1;
|
|
static int hf_infiniband_Trap_MKEY = -1;
|
|
static int hf_infiniband_Trap_DRNotice = -1;
|
|
static int hf_infiniband_Trap_DRPathTruncated = -1;
|
|
static int hf_infiniband_Trap_DRHopCount = -1;
|
|
static int hf_infiniband_Trap_DRNoticeReturnPath = -1;
|
|
|
|
/* Trap 257, 258 */
|
|
static int hf_infiniband_Trap_LIDADDR1 = -1;
|
|
static int hf_infiniband_Trap_LIDADDR2 = -1;
|
|
static int hf_infiniband_Trap_KEY = -1;
|
|
static int hf_infiniband_Trap_SL = -1;
|
|
static int hf_infiniband_Trap_QP1 = -1;
|
|
static int hf_infiniband_Trap_QP2 = -1;
|
|
static int hf_infiniband_Trap_GIDADDR1 = -1;
|
|
static int hf_infiniband_Trap_GIDADDR2 = -1;
|
|
|
|
/* Trap 259 */
|
|
static int hf_infiniband_Trap_DataValid = -1;
|
|
static int hf_infiniband_Trap_PKEY = -1;
|
|
static int hf_infiniband_Trap_SWLIDADDR = -1;
|
|
|
|
/* Trap Type/Descriptions for dissection */
|
|
static const value_string Trap_Description[]= {
|
|
{ 64, " (Informational) <GIDADDR> is now in service"},
|
|
{ 65, " (Informational) <GIDADDR> is out of service"},
|
|
{ 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"},
|
|
{ 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"},
|
|
{ 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"},
|
|
{ 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"},
|
|
{ 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"},
|
|
{ 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"},
|
|
{ 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"},
|
|
{ 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"},
|
|
{ 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
|
|
{ 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"},
|
|
{ 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
|
|
{ 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
|
|
{ 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
|
|
{ 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"},
|
|
{ 0, NULL}
|
|
};
|
|
|
|
|
|
|
|
|
|
/* MAD Management Classes
|
|
* Classes from the Common MAD Header
|
|
*
|
|
* Management Class Name Class Description
|
|
* ------------------------------------------------------------------------------------------------------------ */
|
|
#define SUBN_LID_ROUTED 0x01 /* Subnet Management LID Route */
|
|
#define SUBN_DIRECTED_ROUTE 0x81 /* Subnet Management Directed Route */
|
|
#define SUBNADMN 0x03 /* Subnet Administration */
|
|
#define PERF 0x04 /* Performance Management */
|
|
#define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
|
|
#define DEV_MGT 0x06 /* Device Management */
|
|
#define COM_MGT 0x07 /* Communications Management */
|
|
#define SNMP 0x08 /* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */
|
|
#define VENDOR_1_START 0x09 /* Start of first Vendor Specific Range */
|
|
#define VENDOR_1_END 0x0F /* End of first Vendor Specific Range */
|
|
#define VENDOR_2_START 0x30 /* Start of second Vendor Specific Range */
|
|
#define VENDOR_2_END 0x4F /* End of the second Vendor Specific Range */
|
|
#define APPLICATION_START 0x10 /* Start of Application Specific Range */
|
|
#define APPLICATION_END 0x2F /* End of Application Specific Range */
|
|
|
|
/* Link Next Header Values */
|
|
#define IBA_GLOBAL 3
|
|
#define IBA_LOCAL 2
|
|
#define IP_NON_IBA 1
|
|
#define RAW 0
|
|
|
|
/* OpCodeValues
|
|
* Code Bits [7-5] Connection Type
|
|
* [4-0] Message Type
|
|
|
|
* Reliable Connection (RC)
|
|
* [7-5] = 000 */
|
|
#define RC_SEND_FIRST 0 /*0x00000000 */
|
|
#define RC_SEND_MIDDLE 1 /*0x00000001 */
|
|
#define RC_SEND_LAST 2 /*0x00000010 */
|
|
#define RC_SEND_LAST_IMM 3 /*0x00000011 */
|
|
#define RC_SEND_ONLY 4 /*0x00000100 */
|
|
#define RC_SEND_ONLY_IMM 5 /*0x00000101 */
|
|
#define RC_RDMA_WRITE_FIRST 6 /*0x00000110 */
|
|
#define RC_RDMA_WRITE_MIDDLE 7 /*0x00000111 */
|
|
#define RC_RDMA_WRITE_LAST 8 /*0x00001000 */
|
|
#define RC_RDMA_WRITE_LAST_IMM 9 /*0x00001001 */
|
|
#define RC_RDMA_WRITE_ONLY 10 /*0x00001010 */
|
|
#define RC_RDMA_WRITE_ONLY_IMM 11 /*0x00001011 */
|
|
#define RC_RDMA_READ_REQUEST 12 /*0x00001100 */
|
|
#define RC_RDMA_READ_RESPONSE_FIRST 13 /*0x00001101 */
|
|
#define RC_RDMA_READ_RESPONSE_MIDDLE 14 /*0x00001110 */
|
|
#define RC_RDMA_READ_RESPONSE_LAST 15 /*0x00001111 */
|
|
#define RC_RDMA_READ_RESPONSE_ONLY 16 /*0x00010000 */
|
|
#define RC_ACKNOWLEDGE 17 /*0x00010001 */
|
|
#define RC_ATOMIC_ACKNOWLEDGE 18 /*0x00010010 */
|
|
#define RC_CMP_SWAP 19 /*0x00010011 */
|
|
#define RC_FETCH_ADD 20 /*0x00010100 */
|
|
#define RC_SEND_LAST_INVAL 22 /*0x00010110 */
|
|
#define RC_SEND_ONLY_INVAL 23 /*0x00010111 */
|
|
|
|
/* Reliable Datagram (RD)
|
|
* [7-5] = 010 */
|
|
#define RD_SEND_FIRST 64 /*0x01000000 */
|
|
#define RD_SEND_MIDDLE 65 /*0x01000001 */
|
|
#define RD_SEND_LAST 66 /*0x01000010 */
|
|
#define RD_SEND_LAST_IMM 67 /*0x01000011 */
|
|
#define RD_SEND_ONLY 68 /*0x01000100 */
|
|
#define RD_SEND_ONLY_IMM 69 /*0x01000101 */
|
|
#define RD_RDMA_WRITE_FIRST 70 /*0x01000110 */
|
|
#define RD_RDMA_WRITE_MIDDLE 71 /*0x01000111 */
|
|
#define RD_RDMA_WRITE_LAST 72 /*0x01001000 */
|
|
#define RD_RDMA_WRITE_LAST_IMM 73 /*0x01001001 */
|
|
#define RD_RDMA_WRITE_ONLY 74 /*0x01001010 */
|
|
#define RD_RDMA_WRITE_ONLY_IMM 75 /*0x01001011 */
|
|
#define RD_RDMA_READ_REQUEST 76 /*0x01001100 */
|
|
#define RD_RDMA_READ_RESPONSE_FIRST 77 /*0x01001101 */
|
|
#define RD_RDMA_READ_RESPONSE_MIDDLE 78 /*0x01001110 */
|
|
#define RD_RDMA_READ_RESPONSE_LAST 79 /*0x01001111 */
|
|
#define RD_RDMA_READ_RESPONSE_ONLY 80 /*0x01010000 */
|
|
#define RD_ACKNOWLEDGE 81 /*0x01010001 */
|
|
#define RD_ATOMIC_ACKNOWLEDGE 82 /*0x01010010 */
|
|
#define RD_CMP_SWAP 83 /*0x01010011 */
|
|
#define RD_FETCH_ADD 84 /*0x01010100 */
|
|
#define RD_RESYNC 85 /*0x01010101 */
|
|
|
|
/* Unreliable Datagram (UD)
|
|
* [7-5] = 011 */
|
|
#define UD_SEND_ONLY 100 /*0x01100100 */
|
|
#define UD_SEND_ONLY_IMM 101 /*0x01100101 */
|
|
|
|
/* Unreliable Connection (UC)
|
|
* [7-5] = 001 */
|
|
#define UC_SEND_FIRST 32 /*0x00100000 */
|
|
#define UC_SEND_MIDDLE 33 /*0x00100001 */
|
|
#define UC_SEND_LAST 34 /*0x00100010 */
|
|
#define UC_SEND_LAST_IMM 35 /*0x00100011 */
|
|
#define UC_SEND_ONLY 36 /*0x00100100 */
|
|
#define UC_SEND_ONLY_IMM 37 /*0x00100101 */
|
|
#define UC_RDMA_WRITE_FIRST 38 /*0x00100110 */
|
|
#define UC_RDMA_WRITE_MIDDLE 39 /*0x00100111 */
|
|
#define UC_RDMA_WRITE_LAST 40 /*0x00101000 */
|
|
#define UC_RDMA_WRITE_LAST_IMM 41 /*0x00101001 */
|
|
#define UC_RDMA_WRITE_ONLY 42 /*0x00101010 */
|
|
#define UC_RDMA_WRITE_ONLY_IMM 43 /*0x00101011 */
|
|
|
|
static value_string OpCodeMap[] =
|
|
{
|
|
{ RC_SEND_FIRST, "RC Send First " },
|
|
{ RC_SEND_MIDDLE, "RC Send Middle "},
|
|
{ RC_SEND_LAST, "RC Send Last " },
|
|
{ RC_SEND_LAST_IMM, "RC Send Last Immediate "},
|
|
{ RC_SEND_ONLY, "RC Send Only "},
|
|
{ RC_SEND_ONLY_IMM, "RC Send Only Immediate "},
|
|
{ RC_RDMA_WRITE_FIRST, "RC RDMA Write First " },
|
|
{ RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "},
|
|
{ RC_RDMA_WRITE_LAST, "RC RDMA Write Last "},
|
|
{ RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " },
|
|
{ RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " },
|
|
{ RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "},
|
|
{ RC_RDMA_READ_REQUEST, "RC RDMA Read Request " },
|
|
{ RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " },
|
|
{ RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "},
|
|
{ RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " },
|
|
{ RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "},
|
|
{ RC_ACKNOWLEDGE, "RC Acknowledge " },
|
|
{ RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " },
|
|
{ RC_CMP_SWAP, "RC Compare Swap " },
|
|
{ RC_FETCH_ADD, "RC Fetch Add "},
|
|
{ RC_SEND_LAST_INVAL, "RC Send Last Invalidate "},
|
|
{ RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " },
|
|
|
|
|
|
{ RD_SEND_FIRST, "RD Send First "},
|
|
{ RD_SEND_MIDDLE,"RD Send Middle " },
|
|
{ RD_SEND_LAST, "RD Send Last "},
|
|
{ RD_SEND_LAST_IMM, "RD Last Immediate " },
|
|
{ RD_SEND_ONLY,"RD Send Only "},
|
|
{ RD_SEND_ONLY_IMM,"RD Send Only Immediate "},
|
|
{ RD_RDMA_WRITE_FIRST,"RD RDMA Write First "},
|
|
{ RD_RDMA_WRITE_MIDDLE, "RD RDMA Write Middle "},
|
|
{ RD_RDMA_WRITE_LAST,"RD RDMA Write Last "},
|
|
{ RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "},
|
|
{ RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "},
|
|
{ RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "},
|
|
{ RD_RDMA_READ_REQUEST,"RD RDMA Read Request "},
|
|
{ RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "},
|
|
{ RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "},
|
|
{ RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "},
|
|
{ RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "},
|
|
{ RD_ACKNOWLEDGE,"RD Acknowledge "},
|
|
{ RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "},
|
|
{ RD_CMP_SWAP,"RD Compare Swap "},
|
|
{ RD_FETCH_ADD, "RD Fetch Add "},
|
|
{ RD_RESYNC,"RD RESYNC "},
|
|
|
|
|
|
{ UD_SEND_ONLY, "UD Send Only "},
|
|
{ UD_SEND_ONLY_IMM, "UD Send Only Immediate "},
|
|
|
|
|
|
{ UC_SEND_FIRST,"UC Send First "},
|
|
{ UC_SEND_MIDDLE,"UC Send Middle "},
|
|
{ UC_SEND_LAST,"UC Send Last "},
|
|
{ UC_SEND_LAST_IMM,"UC Send Last Immediate "},
|
|
{ UC_SEND_ONLY,"UC Send Only "},
|
|
{ UC_SEND_ONLY_IMM,"UC Send Only Immediate "},
|
|
{ UC_RDMA_WRITE_FIRST,"UC RDMA Write First"},
|
|
{ UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "},
|
|
{ UC_RDMA_WRITE_LAST,"UC RDMA Write Last "},
|
|
{ UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "},
|
|
{ UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "},
|
|
{ UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "},
|
|
{ 0, NULL}
|
|
|
|
};
|
|
|
|
|
|
|
|
/* Header Ordering Based on OPCODES
|
|
* These are simply an enumeration of the possible header combinations defined by the IB Spec.
|
|
* These enumerations
|
|
* #DEFINE [HEADER_ORDER] [ENUM]
|
|
* __________________________________ */
|
|
#define RDETH_DETH_PAYLD 0
|
|
/* __________________________________ */
|
|
#define RDETH_DETH_RETH_PAYLD 1
|
|
/* __________________________________ */
|
|
#define RDETH_DETH_IMMDT_PAYLD 2
|
|
/* __________________________________ */
|
|
#define RDETH_DETH_RETH_IMMDT_PAYLD 3
|
|
/* __________________________________ */
|
|
#define RDETH_DETH_RETH 4
|
|
/* __________________________________ */
|
|
#define RDETH_AETH_PAYLD 5
|
|
/* __________________________________ */
|
|
#define RDETH_PAYLD 6
|
|
/* __________________________________ */
|
|
#define RDETH_AETH 7
|
|
/* __________________________________ */
|
|
#define RDETH_AETH_ATOMICACKETH 8
|
|
/* __________________________________ */
|
|
#define RDETH_DETH_ATOMICETH 9
|
|
/* ___________________________________ */
|
|
#define RDETH_DETH 10
|
|
/* ___________________________________ */
|
|
#define DETH_PAYLD 11
|
|
/* ___________________________________ */
|
|
#define DETH_IMMDT_PAYLD 12
|
|
/* ___________________________________ */
|
|
#define PAYLD 13
|
|
/* ___________________________________ */
|
|
#define IMMDT_PAYLD 14
|
|
/* ___________________________________ */
|
|
#define RETH_PAYLD 15
|
|
/* ___________________________________ */
|
|
#define RETH_IMMDT_PAYLD 16
|
|
/* ___________________________________ */
|
|
#define RETH 17
|
|
/* ___________________________________ */
|
|
#define AETH_PAYLD 18
|
|
/* ___________________________________ */
|
|
#define AETH 19
|
|
/* ___________________________________ */
|
|
#define AETH_ATOMICACKETH 20
|
|
/* ___________________________________ */
|
|
#define ATOMICETH 21
|
|
/* ___________________________________ */
|
|
#define IETH_PAYLD 22
|
|
/* ___________________________________ */
|
|
|
|
|
|
/* Array of all availavle OpCodes to make matching a bit easier.
|
|
* The OpCodes dictate the header sequence following in the packet.
|
|
* These arrays tell the dissector which headers must be decoded for the given OpCode. */
|
|
static guint32 opCode_RDETH_DETH_ATOMICETH[] = {
|
|
RD_CMP_SWAP,
|
|
RD_FETCH_ADD
|
|
};
|
|
static guint32 opCode_IETH_PAYLD[] = {
|
|
RC_SEND_LAST_INVAL,
|
|
RC_SEND_ONLY_INVAL
|
|
};
|
|
static guint32 opCode_ATOMICETH[] = {
|
|
RC_CMP_SWAP,
|
|
RC_FETCH_ADD
|
|
};
|
|
static guint32 opCode_RDETH_DETH_RETH_PAYLD[] = {
|
|
RD_RDMA_WRITE_FIRST,
|
|
RD_RDMA_WRITE_ONLY
|
|
};
|
|
static guint32 opCode_RETH_IMMDT_PAYLD[] = {
|
|
RC_RDMA_WRITE_ONLY_IMM,
|
|
UC_RDMA_WRITE_ONLY_IMM
|
|
};
|
|
static guint32 opCode_RDETH_DETH_IMMDT_PAYLD[] = {
|
|
RD_SEND_LAST_IMM,
|
|
RD_SEND_ONLY_IMM,
|
|
RD_RDMA_WRITE_LAST_IMM
|
|
};
|
|
|
|
static guint32 opCode_RDETH_AETH_PAYLD[] = {
|
|
RD_RDMA_READ_RESPONSE_FIRST,
|
|
RD_RDMA_READ_RESPONSE_LAST,
|
|
RD_RDMA_READ_RESPONSE_ONLY
|
|
};
|
|
static guint32 opCode_AETH_PAYLD[] = {
|
|
RC_RDMA_READ_RESPONSE_FIRST,
|
|
RC_RDMA_READ_RESPONSE_LAST,
|
|
RC_RDMA_READ_RESPONSE_ONLY
|
|
};
|
|
static guint32 opCode_RETH_PAYLD[] = {
|
|
RC_RDMA_WRITE_FIRST,
|
|
RC_RDMA_WRITE_ONLY,
|
|
UC_RDMA_WRITE_FIRST,
|
|
UC_RDMA_WRITE_ONLY
|
|
};
|
|
|
|
static guint32 opCode_RDETH_DETH_PAYLD[] = {
|
|
RD_SEND_FIRST,
|
|
RD_SEND_MIDDLE,
|
|
RD_SEND_LAST,
|
|
RD_SEND_ONLY,
|
|
RD_RDMA_WRITE_MIDDLE,
|
|
RD_RDMA_WRITE_LAST
|
|
};
|
|
|
|
static guint32 opCode_IMMDT_PAYLD[] = {
|
|
RC_SEND_LAST_IMM,
|
|
RC_SEND_ONLY_IMM,
|
|
RC_RDMA_WRITE_LAST_IMM,
|
|
UC_SEND_LAST_IMM,
|
|
UC_SEND_ONLY_IMM,
|
|
UC_RDMA_WRITE_LAST_IMM
|
|
};
|
|
|
|
static guint32 opCode_PAYLD[] = {
|
|
RC_SEND_FIRST,
|
|
RC_SEND_MIDDLE,
|
|
RC_SEND_LAST,
|
|
RC_SEND_ONLY,
|
|
RC_RDMA_WRITE_MIDDLE,
|
|
RC_RDMA_WRITE_LAST,
|
|
RC_RDMA_READ_RESPONSE_MIDDLE,
|
|
UC_SEND_FIRST,
|
|
UC_SEND_MIDDLE,
|
|
UC_SEND_LAST,
|
|
UC_SEND_ONLY,
|
|
UC_RDMA_WRITE_MIDDLE,
|
|
UC_RDMA_WRITE_LAST
|
|
};
|
|
|
|
/* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
|
|
* We can just decode it directly
|
|
|
|
* static guint32 opCode_DETH_IMMDT_PAYLD[] = {
|
|
* UD_SEND_ONLY_IMM
|
|
* };
|
|
* static guint32 opCode_DETH_PAYLD[] = {
|
|
* UD_SEND_ONLY
|
|
* };
|
|
* static guint32 opCode_RDETH_DETH[] = {
|
|
* RD_RESYNC
|
|
* };
|
|
* static guint32 opCode_RDETH_DETH_RETH[] = {
|
|
* RD_RDMA_READ_REQUEST
|
|
* };
|
|
* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
|
|
* RD_RDMA_WRITE_ONLY_IMM
|
|
* };
|
|
* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = {
|
|
* RD_ATOMIC_ACKNOWLEDGE
|
|
* };
|
|
* static guint32 opCode_RDETH_AETH[] = {
|
|
* RD_ACKNOWLEDGE
|
|
* };
|
|
* static guint32 opCode_RDETH_PAYLD[] = {
|
|
* RD_RDMA_READ_RESPONSE_MIDDLE
|
|
* };
|
|
* static guint32 opCode_AETH_ATOMICACKETH[] = {
|
|
* RC_ATOMIC_ACKNOWLEDGE
|
|
* };
|
|
* static guint32 opCode_RETH[] = {
|
|
* RC_RDMA_READ_REQUEST
|
|
* };
|
|
* static guint32 opCode_AETH[] = {
|
|
* RC_ACKNOWLEDGE
|
|
* }; */
|
|
|
|
|
|
/* Field dissector structures.
|
|
* For reserved fields, reservedX denotes the reserved field is X bits in length.
|
|
* e.g. reserved2 is a reserved field 2 bits in length.
|
|
* The third parameter is a filter string associated for this field.
|
|
* So for instance, to filter packets for a given virtual lane,
|
|
* The filter (infiniband.LRH.vl == 3) or something similar would be used. */
|
|
|
|
static hf_register_info hf[] = {
|
|
|
|
/* Local Route Header (LRH) */
|
|
{&hf_infiniband_LRH,
|
|
{"Local Route Header", "infiniband.lrh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_virtual_lane,
|
|
{"Virtual Lane", "infiniband.lrh.vl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_link_version,
|
|
{"Link Version", "infiniband.lrh.lver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_service_level,
|
|
{"Service Level", "infiniband.lrh.sl", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved2,
|
|
{"Reserved (2 bits)", "infiniband.lrh.reserved2", FT_UINT8, BASE_DEC, NULL, 0x0C, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_link_next_header,
|
|
{"Link Next Header", "infiniband.lrh.lnh", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_destination_local_id,
|
|
{"Destination Local ID", "infiniband.lrh.dlid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved5,
|
|
{"Reserved (5 bits)", "infiniband.lrh.reserved5", FT_UINT16, BASE_DEC, NULL, 0xF800, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_packet_length,
|
|
{"Packet Length", "infiniband.lrh.pktlen", FT_UINT16, BASE_DEC, NULL, 0x07FF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_source_local_id,
|
|
{"Source Local ID", "infiniband.lrh.slid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Global Route Header (GRH) */
|
|
{&hf_infiniband_GRH,
|
|
{"Global Route Header", "infiniband.grh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ip_version,
|
|
{"IP Version", "infiniband.grh.ipver", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_traffic_class,
|
|
{"Traffic Class", "infiniband.grh.tclass", FT_UINT16, BASE_DEC, NULL, 0x0FF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_flow_label,
|
|
{"Flow Label", "infiniband.grh.flowlabel", FT_UINT32, BASE_DEC, NULL, 0x000FFFFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_payload_length,
|
|
{"Payload Length", "infiniband.grh.paylen", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_next_header,
|
|
{"Next Header", "infiniband.grh.nxthdr", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_hop_limit,
|
|
{"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_source_gid,
|
|
{"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_destination_gid,
|
|
{"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Base Transport Header (BTH) */
|
|
{&hf_infiniband_BTH,
|
|
{"Base Transport Header", "infiniband.bth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_opcode,
|
|
{"Opcode", "infiniband.bth.opcode", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_solicited_event,
|
|
{"Solicited Event", "infiniband.bth.se", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_migreq,
|
|
{"MigReq", "infiniband.bth.m", FT_BOOLEAN, BASE_DEC, NULL, 0x40, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_pad_count,
|
|
{"Pad Count", "infiniband.bth.padcnt", FT_UINT8, BASE_DEC, NULL, 0x30, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_transport_header_version,
|
|
{"Header Version", "infiniband.bth.tver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_partition_key,
|
|
{"Partition Key", "infiniband.bth.p_key", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved8,
|
|
{"Reserved (8 bits)", "infiniband.bth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_destination_qp,
|
|
{"Destination Queue Pair", "infiniband.bth.destqp", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_acknowledge_request,
|
|
{"Acknowledge Request", "infiniband.bth.a", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved7,
|
|
{"Reserved (7 bits)", "infiniband.bth.reserved7", FT_UINT8, BASE_DEC, NULL, 0x7F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_packet_sequence_number,
|
|
{"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Raw Header (RWH) */
|
|
{&hf_infiniband_RWH,
|
|
{"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved16_RWH,
|
|
{"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_etype,
|
|
{"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
|
|
},
|
|
|
|
/* Reliable Datagram Extended Transport Header (RDETH) */
|
|
{&hf_infiniband_RDETH,
|
|
{"Reliable Datagram Extended Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved8_RDETH,
|
|
{"Reserved (8 bits)", "infiniband.rdeth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ee_context,
|
|
{"E2E Context", "infiniband.rdeth.eecnxt", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Datagram Extended Transport Header (DETH) */
|
|
{&hf_infiniband_DETH,
|
|
{"Datagram Extended Transport Header", "infiniband.deth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_queue_key,
|
|
{"Queue Key", "infiniband.deth.q_key", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved8_DETH,
|
|
{"Reserved (8 bits)", "infiniband.deth.reserved8", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_source_qp,
|
|
{"Source Queue Pair", "infiniband.deth.srcqp", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* RDMA Extended Transport Header (RETH) */
|
|
{&hf_infiniband_RETH,
|
|
{"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_virtual_address,
|
|
{"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_remote_key,
|
|
{"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_dma_length,
|
|
{"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Atomic Extended Transport Header (AtomicETH) */
|
|
{&hf_infiniband_AtomicETH,
|
|
{"Atomic Extended Transport Header", "infiniband.atomiceth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_virtual_address_AtomicETH,
|
|
{"Virtual Address", "infiniband.atomiceth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_remote_key_AtomicETH,
|
|
{"Remote Key", "infiniband.atomiceth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_swap_or_add_data,
|
|
{"Swap (Or Add) Data", "infiniband.atomiceth.swapdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_compare_data,
|
|
{"Compare Data", "infiniband.atomiceth.cmpdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* ACK Extended Transport Header (AETH) */
|
|
{&hf_infiniband_AETH,
|
|
{"ACK Extended Transport Header", "infiniband.aeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_syndrome,
|
|
{"Syndrome", "infiniband.aeth.syndrome", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_message_sequence_number,
|
|
{"Message Sequence Number", "infiniband.aeth.msn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Atomic ACK Extended Transport Header (AtomicAckETH) */
|
|
{&hf_infiniband_AtomicAckETH,
|
|
{"Atomic ACK Extended Transport Header", "infiniband.atomicacketh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_original_remote_data,
|
|
{"Original Remote Data", "infiniband.atomicacketh.origremdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Immediate Extended Transport Header (ImmDT) */
|
|
{&hf_infiniband_IMMDT,
|
|
{"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Invalidate Extended Transport Header (IETH) */
|
|
{&hf_infiniband_IETH,
|
|
{"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Payload */
|
|
{&hf_infiniband_payload,
|
|
{"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_invariant_crc,
|
|
{"Invariant CRC", "infiniband.invariant.crc", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_variant_crc,
|
|
{"Variant CRC", "infiniband.variant.crc", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_raw_data,
|
|
{"Raw Data", "infiniband.rawdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Unknown or Vendor Specific */
|
|
{&hf_infiniband_vendor,
|
|
{"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* MAD Base Header */
|
|
{&hf_infiniband_MAD,
|
|
{"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_base_version,
|
|
{"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_mgmt_class,
|
|
{"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_class_version,
|
|
{"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved1,
|
|
{"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_method,
|
|
{"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_status,
|
|
{"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_class_specific,
|
|
{"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_transaction_id,
|
|
{"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_attribute_id,
|
|
{"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved16,
|
|
{"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_attribute_modifier,
|
|
{"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_data,
|
|
{"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* RMPP Header */
|
|
{&hf_infiniband_RMPP,
|
|
{"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_version,
|
|
{"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_type,
|
|
{"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_r_resp_time,
|
|
{"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_flags,
|
|
{"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_status,
|
|
{"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_data1,
|
|
{"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_rmpp_data2,
|
|
{"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* RMPP Data */
|
|
{&hf_infiniband_RMPP_DATA,
|
|
{"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_segment_number,
|
|
{"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_payload_length32,
|
|
{"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_transferred_data,
|
|
{"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* RMPP ACK */
|
|
{&hf_infiniband_new_window_last,
|
|
{"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved220,
|
|
{"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* RMPP ABORT/STOP */
|
|
{&hf_infiniband_optional_extended_error_data,
|
|
{"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* SMP Data (LID Routed) */
|
|
{&hf_infiniband_SMP_LID,
|
|
{"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_m_key,
|
|
{"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_smp_data,
|
|
{"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved1024,
|
|
{"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved256,
|
|
{"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* SMP Data Directed Route */
|
|
{&hf_infiniband_SMP_DIRECTED,
|
|
{"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_smp_status,
|
|
{"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_hop_pointer,
|
|
{"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_hop_count,
|
|
{"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_dr_slid,
|
|
{"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_dr_dlid,
|
|
{"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_reserved28,
|
|
{"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_d,
|
|
{"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_initial_path,
|
|
{"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_return_path,
|
|
{"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* SA MAD Header */
|
|
{&hf_infiniband_SA,
|
|
{"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_sm_key,
|
|
{"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_attribute_offset,
|
|
{"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_component_mask,
|
|
{"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_subnet_admin_data,
|
|
{"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* NodeDescription */
|
|
{&hf_infiniband_NodeDescription_NodeString,
|
|
{"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* NodeInfo */
|
|
{&hf_infiniband_NodeInfo_BaseVersion,
|
|
{"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_ClassVersion,
|
|
{"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_NodeType,
|
|
{"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_NumPorts,
|
|
{"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_SystemImageGUID,
|
|
{"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_NodeGUID,
|
|
{"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_PortGUID,
|
|
{"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_PartitionCap,
|
|
{"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_DeviceID,
|
|
{"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_Revision,
|
|
{"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_LocalPortNum,
|
|
{"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_NodeInfo_VendorID,
|
|
{"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* SwitchInfo */
|
|
{&hf_infiniband_SwitchInfo_LinearFDBCap,
|
|
{"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_RandomFDBCap,
|
|
{"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_MulticastFDBCap,
|
|
{"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_LinearFDBTop,
|
|
{"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_DefaultPort,
|
|
{"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,
|
|
{"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,
|
|
{"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_LifeTimeValue,
|
|
{"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_PortStateChange,
|
|
{"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming,
|
|
{"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_LIDsPerPort,
|
|
{"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_PartitionEnforcementCap,
|
|
{"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_InboundEnforcementCap,
|
|
{"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_OutboundEnforcementCap,
|
|
{"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_FilterRawInboundCap,
|
|
{"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_FilterRawOutboundCap,
|
|
{"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SwitchInfo_EnhancedPortZero,
|
|
{"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
|
|
},
|
|
/* GUIDInfo */
|
|
{&hf_infiniband_GUIDInfo_GUIDBlock,
|
|
{"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_GUIDInfo_GUID,
|
|
{"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* PortInfo */
|
|
{&hf_infiniband_PortInfo_M_Key,
|
|
{"M_Key", "infiniband.portinfo.m_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_GidPrefix,
|
|
{"GidPrefix", "infiniband.portinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LID,
|
|
{"LID", "infiniband.portinfo.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_MasterSMLID,
|
|
{"MasterSMLID", "infiniband.portinfo.mastersmlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask,
|
|
{"CapabilityMask", "infiniband.portinfo.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
|
|
/* Capability Mask Flags */
|
|
{&hf_infiniband_PortInfo_CapabilityMask_SM,
|
|
{"SM", "infiniband.portinfo.capabilitymask.issm", FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,
|
|
{"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported", FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_TrapSupported,
|
|
{"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported", FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,
|
|
{"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported", FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,
|
|
{"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported", FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,
|
|
{"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported", FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,
|
|
{"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,
|
|
{"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,
|
|
{"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported", FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_SMdisabled,
|
|
{"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled", FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,
|
|
{"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported", FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,
|
|
{"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported", FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,
|
|
{"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,
|
|
{"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported", FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,
|
|
{"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported", FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,
|
|
{"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,
|
|
{"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported", FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,
|
|
{"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,
|
|
{"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,
|
|
{"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,
|
|
{"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported", FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,
|
|
{"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported", FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,
|
|
{"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,
|
|
{"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported", FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
|
|
},
|
|
/* End Capability Mask Flags */
|
|
|
|
{&hf_infiniband_PortInfo_DiagCode,
|
|
{"DiagCode", "infiniband.portinfo.diagcode", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_M_KeyLeasePeriod,
|
|
{"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LocalPortNum,
|
|
{"LocalPortNum", "infiniband.portinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkWidthEnabled,
|
|
{"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkWidthSupported,
|
|
{"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkWidthActive,
|
|
{"LinkWidthActive", "infiniband.portinfo.linkwidthactive", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkSpeedSupported,
|
|
{"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_PortState,
|
|
{"PortState", "infiniband.portinfo.portstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_PortPhysicalState,
|
|
{"PortPhysicalState", "infiniband.portinfo.portphysicalstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkDownDefaultState,
|
|
{"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_M_KeyProtectBits,
|
|
{"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LMC,
|
|
{"LMC", "infiniband.portinfo.lmc", FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkSpeedActive,
|
|
{"LinkSpeedActive", "infiniband.portinfo.linkspeedactive", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkSpeedEnabled,
|
|
{"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_NeighborMTU,
|
|
{"NeighborMTU", "infiniband.portinfo.neighbormtu", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_MasterSMSL,
|
|
{"MasterSMSL", "infiniband.portinfo.mastersmsl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_VLCap,
|
|
{"VLCap", "infiniband.portinfo.vlcap", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_InitType,
|
|
{"InitType", "infiniband.portinfo.inittype", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_VLHighLimit,
|
|
{"VLHighLimit", "infiniband.portinfo.vlhighlimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_VLArbitrationHighCap,
|
|
{"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_VLArbitrationLowCap,
|
|
{"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_InitTypeReply,
|
|
{"InitTypeReply", "infiniband.portinfo.inittypereply", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_MTUCap,
|
|
{"MTUCap", "infiniband.portinfo.mtucap", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_VLStallCount,
|
|
{"VLStallCount", "infiniband.portinfo.vlstallcount", FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_HOQLife,
|
|
{"HOQLife", "infiniband.portinfo.hoqlife", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_OperationalVLs,
|
|
{"OperationalVLs", "infiniband.portinfo.operationalvls", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_PartitionEnforcementInbound,
|
|
{"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_PartitionEnforcementOutbound,
|
|
{"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_FilterRawInbound,
|
|
{"FilterRawInbound", "infiniband.portinfo.filterrawinbound", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_FilterRawOutbound,
|
|
{"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_M_KeyViolations,
|
|
{"M_KeyViolations", "infiniband.portinfo.m_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_P_KeyViolations,
|
|
{"P_KeyViolations", "infiniband.portinfo.p_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_Q_KeyViolations,
|
|
{"Q_KeyViolations", "infiniband.portinfo.q_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_GUIDCap,
|
|
{"GUIDCap", "infiniband.portinfo.guidcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_ClientReregister,
|
|
{"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_SubnetTimeOut,
|
|
{"SubnetTimeOut", "infiniband.portinfo.subnettimeout", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_RespTimeValue,
|
|
{"RespTimeValue", "infiniband.portinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LocalPhyErrors,
|
|
{"LocalPhyErrors", "infiniband.portinfo.localphyerrors", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_OverrunErrors,
|
|
{"OverrunErrors", "infiniband.portinfo.overrunerrors", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_MaxCreditHint,
|
|
{"MaxCreditHint", "infiniband.portinfo.maxcredithint", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PortInfo_LinkRoundTripLatency,
|
|
{"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* P_KeyTable */
|
|
{&hf_infiniband_P_KeyTable_P_KeyTableBlock,
|
|
{"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_P_KeyTable_MembershipType,
|
|
{"MembershipType", "infiniband.p_keytable.membershiptype", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_P_KeyTable_P_KeyBase,
|
|
{"P_KeyBase", "infiniband.p_keytable.p_keybase", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
|
|
},
|
|
/* SLtoVLMappingTable */
|
|
{&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,
|
|
{"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,
|
|
{"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
/* VLArbitrationTable */
|
|
{&hf_infiniband_VLArbitrationTable_VLWeightPairs,
|
|
{"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_VLArbitrationTable_VL,
|
|
{"VL", "infiniband.vlarbitrationtable.vl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_VLArbitrationTable_Weight,
|
|
{"Weight", "infiniband.vlarbitrationtable.weight", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* LinearForwardingTable */
|
|
{&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock,
|
|
{"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinearForwardingTable_Port,
|
|
{"Port", "infiniband.linearforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* RandomForwardingTable */
|
|
{&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock,
|
|
{"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_RandomForwardingTable_LID,
|
|
{"LID", "infiniband.randomforwardingtable.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_RandomForwardingTable_Valid,
|
|
{"Valid", "infiniband.randomforwardingtable.valid", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_RandomForwardingTable_LMC,
|
|
{"LMC", "infiniband.randomforwardingtable.lmc", FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_RandomForwardingTable_Port,
|
|
{"Port", "infiniband.randomforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* MulticastForwardingTable */
|
|
{&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock ,
|
|
{"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MulticastForwardingTable_PortMask,
|
|
{"PortMask", "infiniband.multicastforwardingtable.portmask", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* SMInfo */
|
|
{&hf_infiniband_SMInfo_GUID,
|
|
{"GUID", "infiniband.sminfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SMInfo_SM_Key,
|
|
{"SM_Key", "infiniband.sminfo.sm_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SMInfo_ActCount,
|
|
{"ActCount", "infiniband.sminfo.actcount", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SMInfo_Priority,
|
|
{"Priority", "infiniband.sminfo.priority", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SMInfo_SMState,
|
|
{"SMState", "infiniband.sminfo.smstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
/* VendorDiag */
|
|
{&hf_infiniband_VendorDiag_NextIndex,
|
|
{"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_VendorDiag_DiagData,
|
|
{"DiagData", "infiniband.vendordiag.diagdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* LedInfo */
|
|
{&hf_infiniband_LedInfo_LedMask,
|
|
{"LedMask", "infiniband.ledinfo.ledmask", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
/* LinkSpeedWidthPairsTable */
|
|
{&hf_infiniband_LinkSpeedWidthPairsTable_NumTables,
|
|
{"NumTables", "infiniband.linkspeedwidthpairstable.numtables", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkSpeedWidthPairsTable_PortMask,
|
|
{"PortMask", "infiniband.linkspeedwidthpairstable.portmask", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,
|
|
{"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,
|
|
{"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,
|
|
{"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
/* NodeRecord */
|
|
/* PortInfoRecord */
|
|
/* SLtoVLMappingTableRecord */
|
|
/* SwitchInfoRecord */
|
|
/* LinearForwardingTableRecord */
|
|
/* RandomForwardingTableRecord */
|
|
/* MulticastForwardingTableRecord */
|
|
/* VLArbitrationTableRecord */
|
|
{&hf_infiniband_SA_LID,
|
|
{"LID", "infiniband.sa.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_EndportLID,
|
|
{"EndportLID", "infiniband.sa.endportlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_PortNum,
|
|
{"PortNum", "infiniband.sa.portnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_InputPortNum ,
|
|
{"InputPortNum ", "infiniband.sa.inputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_OutputPortNum,
|
|
{"OutputPortNum", "infiniband.sa.outputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_BlockNum_EightBit,
|
|
{"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_BlockNum_NineBit,
|
|
{"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit", FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_BlockNum_SixteenBit,
|
|
{"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_Position,
|
|
{"Position", "infiniband.sa.position", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_SA_Index,
|
|
{"Index", "infiniband.sa.index", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* InformInfoRecord */
|
|
{&hf_infiniband_InformInfoRecord_SubscriberGID,
|
|
{"SubscriberGID", "infiniband.informinforecord.subscribergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfoRecord_Enum,
|
|
{"Enum", "infiniband.informinforecord.enum", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* InformInfo */
|
|
{&hf_infiniband_InformInfo_GID,
|
|
{"GID", "infiniband.informinfo.gid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_LIDRangeBegin,
|
|
{"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_LIDRangeEnd,
|
|
{"LIDRangeEnd", "infiniband.informinfo.lidrangeend", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_IsGeneric,
|
|
{"IsGeneric", "infiniband.informinfo.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_Subscribe,
|
|
{"Subscribe", "infiniband.informinfo.subscribe", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_Type,
|
|
{"Type", "infiniband.informinfo.type", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_TrapNumberDeviceID,
|
|
{"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_QPN,
|
|
{"QPN", "infiniband.informinfo.qpn", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_RespTimeValue,
|
|
{"RespTimeValue", "infiniband.informinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_InformInfo_ProducerTypeVendorID,
|
|
{"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* LinkRecord */
|
|
{&hf_infiniband_LinkRecord_FromLID,
|
|
{"FromLID", "infiniband.linkrecord.fromlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkRecord_FromPort,
|
|
{"FromPort", "infiniband.linkrecord.fromport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkRecord_ToPort,
|
|
{"ToPort", "infiniband.linkrecord.toport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_LinkRecord_ToLID,
|
|
{"ToLID", "infiniband.linkrecord.tolid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* ServiceRecord */
|
|
{&hf_infiniband_ServiceRecord_ServiceID,
|
|
{"ServiceID", "infiniband.linkrecord.serviceid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceGID,
|
|
{"ServiceGID", "infiniband.linkrecord.servicegid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceP_Key,
|
|
{"ServiceP_Key", "infiniband.linkrecord.servicep_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceLease,
|
|
{"ServiceLease", "infiniband.linkrecord.servicelease", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceKey,
|
|
{"ServiceKey", "infiniband.linkrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceName,
|
|
{"ServiceName", "infiniband.linkrecord.servicename", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceRecord_ServiceData,
|
|
{"ServiceData", "infiniband.linkrecord.servicedata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* ServiceAssociationRecord */
|
|
{&hf_infiniband_ServiceAssociationRecord_ServiceKey,
|
|
{"ServiceKey", "infiniband.serviceassociationrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_ServiceAssociationRecord_ServiceName,
|
|
{"ServiceName", "infiniband.serviceassociationrecord.servicename", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* PathRecord */
|
|
{&hf_infiniband_PathRecord_DGID,
|
|
{"DGID", "infiniband.pathrecord.dgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_SGID,
|
|
{"SGID", "infiniband.pathrecord.sgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_DLID,
|
|
{"DLID", "infiniband.pathrecord.dlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_SLID,
|
|
{"SLID", "infiniband.pathrecord.slid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_RawTraffic,
|
|
{"RawTraffic", "infiniband.pathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_FlowLabel,
|
|
{"FlowLabel", "infiniband.pathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_HopLimit,
|
|
{"HopLimit", "infiniband.pathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_TClass,
|
|
{"TClass", "infiniband.pathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_Reversible,
|
|
{"Reversible", "infiniband.pathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_NumbPath,
|
|
{"NumbPath", "infiniband.pathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_P_Key,
|
|
{"P_Key", "infiniband.pathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_SL,
|
|
{"SL", "infiniband.pathrecord.sl", FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_MTUSelector,
|
|
{"MTUSelector", "infiniband.pathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_MTU,
|
|
{"MTU", "infiniband.pathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_RateSelector,
|
|
{"RateSelector", "infiniband.pathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_Rate,
|
|
{"Rate", "infiniband.pathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_PacketLifeTimeSelector,
|
|
{"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_PacketLifeTime,
|
|
{"PacketLifeTime", "infiniband.pathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_PathRecord_Preference,
|
|
{"Preference", "infiniband.pathrecord.preference", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* MCMemberRecord */
|
|
{&hf_infiniband_MCMemberRecord_MGID,
|
|
{"MGID", "infiniband.mcmemberrecord.mgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_PortGID,
|
|
{"PortGID", "infiniband.mcmemberrecord.portgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_Q_Key,
|
|
{"Q_Key", "infiniband.mcmemberrecord.q_key", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_MLID,
|
|
{"MLID", "infiniband.mcmemberrecord.mlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_MTUSelector,
|
|
{"MTUSelector", "infiniband.mcmemberrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_MTU,
|
|
{"MTU", "infiniband.mcmemberrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_TClass,
|
|
{"TClass", "infiniband.mcmemberrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_P_Key,
|
|
{"P_Key", "infiniband.mcmemberrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_RateSelector,
|
|
{"RateSelector", "infiniband.mcmemberrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_Rate,
|
|
{"Rate", "infiniband.mcmemberrecord.rate", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,
|
|
{"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_PacketLifeTime,
|
|
{"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_SL,
|
|
{"SL", "infiniband.mcmemberrecord.sl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_FlowLabel,
|
|
{"FlowLabel", "infiniband.mcmemberrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_HopLimit,
|
|
{"HopLimit", "infiniband.mcmemberrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_Scope,
|
|
{"Scope", "infiniband.mcmemberrecord.scope", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_JoinState,
|
|
{"JoinState", "infiniband.mcmemberrecord.joinstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MCMemberRecord_ProxyJoin,
|
|
{"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
|
|
},
|
|
/* MultiPathRecord */
|
|
{&hf_infiniband_MultiPathRecord_RawTraffic,
|
|
{"RawTraffic", "infiniband.multipathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_FlowLabel,
|
|
{"FlowLabel", "infiniband.multipathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_HopLimit,
|
|
{"HopLimit", "infiniband.multipathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_TClass,
|
|
{"TClass", "infiniband.multipathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_Reversible,
|
|
{"Reversible", "infiniband.multipathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_NumbPath,
|
|
{"NumbPath", "infiniband.multipathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_P_Key,
|
|
{"P_Key", "infiniband.multipathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_SL,
|
|
{"SL", "infiniband.multipathrecord.sl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_MTUSelector,
|
|
{"MTUSelector", "infiniband.multipathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_MTU,
|
|
{"MTU", "infiniband.multipathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_RateSelector,
|
|
{"RateSelector", "infiniband.multipathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_Rate,
|
|
{"Rate", "infiniband.multipathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,
|
|
{"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_PacketLifeTime,
|
|
{"PacketLifeTime", "infiniband.multipathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_IndependenceSelector,
|
|
{"IndependenceSelector", "infiniband.multipathrecord.independenceselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_GIDScope,
|
|
{"GIDScope", "infiniband.multipathrecord.gidscope", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_SGIDCount,
|
|
{"SGIDCount", "infiniband.multipathrecord.sgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_DGIDCount,
|
|
{"DGIDCount", "infiniband.multipathrecord.dgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_MultiPathRecord_SDGID,
|
|
{"SDGID", "infiniband.multipathrecord.sdgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Notice */
|
|
{&hf_infiniband_Notice_IsGeneric,
|
|
{"IsGeneric", "infiniband.notice.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_Type,
|
|
{"Type", "infiniband.notice.type", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_ProducerTypeVendorID,
|
|
{"ProducerTypeVendorID", "infiniband.notice.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_TrapNumberDeviceID,
|
|
{"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_IssuerLID,
|
|
{"IssuerLID", "infiniband.notice.issuerlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_NoticeToggle,
|
|
{"NoticeToggle", "infiniband.notice.noticetoggle", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_NoticeCount,
|
|
{"NoticeCount", "infiniband.notice.noticecount", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_DataDetails,
|
|
{"DataDetails", "infiniband.notice.datadetails", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_IssuerGID,
|
|
{"IssuerGID", "infiniband.notice.issuergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Notice_ClassTrapSpecificData,
|
|
{"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Traps 64,65,66,67 */
|
|
{&hf_infiniband_Trap_GIDADDR,
|
|
{"GIDADDR", "infiniband.trap.gidaddr", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Traps 68,69 */
|
|
{&hf_infiniband_Trap_COMP_MASK,
|
|
{"COMP_MASK", "infiniband.trap.comp_mask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_WAIT_FOR_REPATH,
|
|
{"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_PATH_REC,
|
|
{"PATH_REC", "infiniband.trap.path_rec", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Trap 128 */
|
|
{&hf_infiniband_Trap_LIDADDR,
|
|
{"LIDADDR", "infiniband.trap.lidaddr", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Trap 129, 130, 131 */
|
|
{&hf_infiniband_Trap_PORTNO,
|
|
{"PORTNO", "infiniband.trap.portno", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
/* Trap 144 */
|
|
{&hf_infiniband_Trap_OtherLocalChanges,
|
|
{"OtherLocalChanges", "infiniband.trap.otherlocalchanges", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_CAPABILITYMASK,
|
|
{"CAPABILITYMASK", "infiniband.trap.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_LinkSpeecEnabledChange,
|
|
{"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_LinkWidthEnabledChange,
|
|
{"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_NodeDescriptionChange,
|
|
{"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
/* Trap 145 */
|
|
{&hf_infiniband_Trap_SYSTEMIMAGEGUID,
|
|
{"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
/* Trap 256 */
|
|
{&hf_infiniband_Trap_DRSLID,
|
|
{"DRSLID", "infiniband.trap.drslid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_METHOD,
|
|
{"METHOD", "infiniband.trap.method", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_ATTRIBUTEID,
|
|
{"ATTRIBUTEID", "infiniband.trap.attributeid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_ATTRIBUTEMODIFIER,
|
|
{"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_MKEY,
|
|
{"MKEY", "infiniband.trap.mkey", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_DRNotice,
|
|
{"DRNotice", "infiniband.trap.drnotice", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_DRPathTruncated,
|
|
{"DRPathTruncated", "infiniband.trap.drpathtruncated", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_DRHopCount,
|
|
{"DRHopCount", "infiniband.trap.drhopcount", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_DRNoticeReturnPath,
|
|
{"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath", FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
/* Trap 257, 258 */
|
|
{&hf_infiniband_Trap_LIDADDR1,
|
|
{"LIDADDR1", "infiniband.trap.lidaddr1", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_LIDADDR2,
|
|
{"LIDADDR2", "infiniband.trap.lidaddr2", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_KEY,
|
|
{"KEY", "infiniband.trap.key", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_SL,
|
|
{"SL", "infiniband.trap.sl", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_QP1,
|
|
{"QP1", "infiniband.trap.qp1", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_QP2,
|
|
{"QP2", "infiniband.trap.qp2", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_GIDADDR1,
|
|
{"GIDADDR1", "infiniband.trap.gidaddr1", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_GIDADDR2,
|
|
{"GIDADDR2", "infiniband.trap.gidaddr2", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
/* Trap 259 */
|
|
{&hf_infiniband_Trap_DataValid,
|
|
{"DataValid", "infiniband.trap.datavalid", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_PKEY,
|
|
{"PKEY", "infiniband.trap.pkey", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
},
|
|
{&hf_infiniband_Trap_SWLIDADDR,
|
|
{"SWLIDADDR", "infiniband.trap.swlidaddr", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
|
|
}
|
|
};
|
|
|
|
/* Array to hold expansion options between dissections */
|
|
static gint *ett[] = {
|
|
&ett_infiniband,
|
|
&ett_all_headers,
|
|
&ett_lrh,
|
|
&ett_grh,
|
|
&ett_bth,
|
|
&ett_rwh,
|
|
&ett_rawdata,
|
|
&ett_rdeth,
|
|
&ett_deth,
|
|
&ett_reth,
|
|
&ett_atomiceth,
|
|
&ett_aeth,
|
|
&ett_atomicacketh,
|
|
&ett_immdt,
|
|
&ett_ieth,
|
|
&ett_payload,
|
|
&ett_vendor,
|
|
&ett_subn_lid_routed,
|
|
&ett_subn_directed_route,
|
|
&ett_subnadmin,
|
|
&ett_mad,
|
|
&ett_rmpp,
|
|
&ett_subm_attribute,
|
|
&ett_suba_attribute,
|
|
&ett_datadetails,
|
|
&ett_noticestraps,
|
|
&ett_nodedesc,
|
|
&ett_nodeinfo,
|
|
&ett_switchinfo,
|
|
&ett_guidinfo,
|
|
&ett_portinfo,
|
|
&ett_portinfo_capmask,
|
|
&ett_pkeytable,
|
|
&ett_sltovlmapping,
|
|
&ett_vlarbitrationtable,
|
|
&ett_linearforwardingtable,
|
|
&ett_randomforwardingtable,
|
|
&ett_multicastforwardingtable,
|
|
&ett_sminfo,
|
|
&ett_vendordiag,
|
|
&ett_ledinfo,
|
|
&ett_linkspeedwidthpairs,
|
|
&ett_informinfo,
|
|
&ett_linkrecord,
|
|
&ett_servicerecord,
|
|
&ett_pathrecord,
|
|
&ett_mcmemberrecord,
|
|
&ett_tracerecord,
|
|
&ett_multipathrecord,
|
|
&ett_serviceassocrecord
|
|
};
|
|
|
|
|
|
#endif
|